DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and YDR109C

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_010394.3 Gene:YDR109C / 851687 SGDID:S000002516 Length:715 Species:Saccharomyces cerevisiae


Alignment Length:279 Identity:50/279 - (17%)
Similarity:94/279 - (33%) Gaps:84/279 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 SKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLE-----------PGCSV 149
            :.::||  ..|.:...|.|......|:...:.|.|.::.: |:...|..           .|..:
Yeast   468 NSIEDL--AVMYLSACEFISQQTRQIIEVMLKSGHEINAI-FMSGGQCRNSLLMRLLADCTGLPI 529

  Fly   150 LLNHKVHAVV--------GVLSDDTD--PMVTVMKLEKAPQ-------ETYADIGGLDTQIQEIK 197
            ::...|.|.|        ...|:|.|  .....:|.:|:.|       ::|:.|..|.   .|.:
Yeast   530 VIPRYVDAAVVFGSALLGAAASEDFDYTREKRTLKGQKSSQTKTERFNDSYSSIQKLS---MEDR 591

  Fly   198 ESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGK------TLLAKAVANQTSATFLRVVGSELIQ 256
            .|..            |...|..:.|..|....|      .:..:...::||....:.....:.|
Yeast   592 NSTN------------GFVSPHNLQLSTPSAPAKINNYSLPICTQQPLDKTSEESSKDASLTVGQ 644

  Fly   257 KYLGDGP--------KLVRELFRVA------EEHAPSIVFIDE-----IDAVGTKRYDSNSGGER 302
            :.||:|.        |:::||...|      |:..|..:.:|.     :|.:             
Yeast   645 ESLGEGRYNGTSFLWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMI------------- 696

  Fly   303 EIQRTMLELLNQLDGFDSR 321
            |.||....::::::|..||
Yeast   697 ETQRKYRRMVDKVEGSFSR 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 50/279 (18%)
YDR109CNP_010394.3 FGGY_YpCarbK_like 38..703 CDD:212663 47/265 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.