DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and AT1G45000

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_175120.1 Gene:AT1G45000 / 841065 AraportID:AT1G45000 Length:399 Species:Arabidopsis thaliana


Alignment Length:390 Identity:167/390 - (42%)
Similarity:244/390 - (62%) Gaps:8/390 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQERLKPQDEKNEEERSKVDDLRGTP 105
            |.|||.:  :....|..|.|||..:.::..:....|   |....|.:..|.|::   :..|:...
plant     4 GDDAARR--RTAAVTDYRKKLLHHKELESRVRTARE---NLRAAKKEFNKTEDD---LKSLQSVG 60

  Fly   106 MSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMV 170
            ..:|.:...:|:...||..|.|..:.|...|.|||::|..|..|:|:.....::..|..:.||:|
plant    61 QIIGEVLRPLDNERLIVKASSGPRYVVGCRSKVDKEKLTSGTRVVLDMTTLTIMRALPREVDPVV 125

  Fly   171 TVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLA 235
            ..|..|.....:|:.:|||..||:|::||:||||.:||.:..:||||||||:|||||||||||||
plant   126 YNMLHEDPGNISYSAVGGLGDQIRELRESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLA 190

  Fly   236 KAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGG 300
            :|:|:...|.||:||.|.:|.||:|:..:|:||:|..|.||.|.|:|:|||||:|.:|:...:..
plant   191 RAIASNIDANFLKVVSSAIIDKYIGESARLIREMFNYAREHQPCIIFMDEIDAIGGRRFSEGTSA 255

  Fly   301 EREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFT 365
            :||||||::||||||||||..|.||:||||||.:.|||||:||||:|||||.|||:|:::..|..
plant   256 DREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILK 320

  Fly   366 IHTSRMTLAEDVNLSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKK 430
            ||.|.:....:::...::...:..:|||::.||||||:.|:|..|..|.:|||.|:...:...||
plant   321 IHASGIAKHGEIDYEAIVKLGEGFNGADLRNICTEAGMFAIRAERDYVIHEDFMKAVRKLSEAKK 385

  Fly   431  430
            plant   386  385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 167/390 (43%)
AT1G45000NP_175120.1 RPT1 17..390 CDD:224143 162/375 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D571919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.