DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and KATNAL2

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001340828.1 Gene:KATNAL2 / 83473 HGNCID:25387 Length:564 Species:Homo sapiens


Alignment Length:442 Identity:131/442 - (29%)
Similarity:204/442 - (46%) Gaps:94/442 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KKKKYEPPIPTRVGKKKRRAKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQERL 84
            |.:||    |..|.|....|:.     .|||     |.|.|..:        ||.|. .:|..::
Human   108 KFQKY----PKIVKKSSDTAEN-----NLPQ-----RSRGKTRR--------MMNDS-CQNLPKI 149

  Fly    85 KPQDEKNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLE----P 145
            ..|..:::....|..|.:.......| :|::|      :|.:.|.::...:|.:.||..|    |
Human   150 NQQRPRSKTTAGKTGDTKSLNKEHPN-QEVVD------NTRLESANFGLHISRIRKDSGEENAHP 207

  Fly   146 GCSVLLNHK---VHAVVGVLSD--------DTDPMVTVMKLEKA--------------------- 178
            ....:::.:   ..|:.|..|:        :.||...::|...|                     
Human   208 RRGQIIDFQGLLTDAIKGATSELALNTFDHNPDPSERLLKPLSAFIGMNSEMRELAAVVSRDIYL 272

  Fly   179 --PQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQ 241
              |...:.||.|||...|.:||:|..|:.:|:.:..: :.|.||::|||||||||||||||||.:
Human   273 HNPNIKWNDIIGLDAAKQLVKEAVVYPIRYPQLFTGI-LSPWKGLLLYGPPGTGKTLLAKAVATE 336

  Fly   242 TSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGERE-IQ 305
            ...||..:..|.::.|:.||..||||.||.:|..||||.:|:||:::|.::| .:.||||.| ..
Human   337 CKTTFFNISASTIVSKWRGDSEKLVRVLFELARYHAPSTIFLDELESVMSQR-GTASGGEHEGSL 400

  Fly   306 RTMLELLNQLDGFDSRGD-VKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEK----------- 358
            |...|||.|:||.....| |.|:.|:|....||.|::|  |::::|...||..:           
Human   401 RMKTELLVQMDGLARSEDLVFVLAASNLPWELDCAMLR--RLEKRILVDLPSREARQAMIYHWLP 463

  Fly   359 --TKRRIFTIHTSRMTLAEDVNLSELIMAKDDLSGADIKAICTEAGLMALRE 408
              :|.|...:||       ::..|.|....:..||:|||.:|.||.:..:|:
Human   464 PVSKSRALELHT-------ELEYSVLSQETEGYSGSDIKLVCREAAMRPVRK 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 131/442 (30%)
KATNAL2NP_001340828.1 LisH 51..81 CDD:128913
SpoVK <264..559 CDD:223540 94/256 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.