DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and RPT4A

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_199115.1 Gene:RPT4A / 834316 AraportID:AT5G43010 Length:399 Species:Arabidopsis thaliana


Alignment Length:377 Identity:166/377 - (44%)
Similarity:244/377 - (64%) Gaps:14/377 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RLKLLKLERIKDYLMMEDEFIRNQERLKPQDEKNEEERSKVDDLRGTPMSVGN-LEEI---IDDN 118
            |.|||:.:.::..:....|.:|..::     |.|:.|    |||:.. .|||. :.|:   :|:.
plant    19 RKKLLQHKELESRVRTARENLRGAKK-----EFNKTE----DDLKSL-QSVGQIIGEVLRPLDNE 73

  Fly   119 HAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETY 183
            ..||..|.|..:.|...|.|||::|..|..|:|:.....::..|..:.||:|..|..|.....:|
plant    74 RLIVKASSGPRYVVGCRSKVDKEKLTSGTRVVLDMTTLTIMRALPREVDPVVYNMLHEDPGNISY 138

  Fly   184 ADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLR 248
            :.:|||..||:|::||:||||.:||.:..:||||||||:|||||||||||||:|:|:...|.||:
plant   139 SAVGGLGDQIRELRESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLK 203

  Fly   249 VVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLN 313
            ||.|.:|.||:|:..:|:||:|..|.||.|.|:|:|||||:|.:|:...:..:||||||::||||
plant   204 VVSSAIIDKYIGESARLIREMFNYAREHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLN 268

  Fly   314 QLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVN 378
            ||||||:.|.||:||||||.:.|||||:||||:|||||.|||:|:::..|..||.:.:....:::
plant   269 QLDGFDNLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMDILKIHAAGIAKHGEID 333

  Fly   379 LSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKK 430
            ...::...:..:|||::.||||||:.|:|..|..|.:|||.|:...:...||
plant   334 YEAIVKLAEGFNGADLRNICTEAGMFAIRAERDYVIHEDFMKAVRKLSEAKK 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 166/377 (44%)
RPT4ANP_199115.1 RPT1 17..390 CDD:224143 166/377 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D571919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.