DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and RPT5A

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_187204.1 Gene:RPT5A / 819718 AraportID:AT3G05530 Length:424 Species:Arabidopsis thaliana


Alignment Length:411 Identity:182/411 - (44%)
Similarity:258/411 - (62%) Gaps:35/411 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 AAMKLPQVTPHTRC---RLKLLKLERIKDYLMMEDEFIRNQERLKPQDEKNEEERSKVDDLRGTP 105
            |:|....:|..||.   .:::||          ||....|.| .....||.:|.:.|:...:..|
plant    18 ASMSTEDITRATRLLDNEIRILK----------EDAQRTNLE-CDSYKEKIKENQEKIKLNKQLP 71

  Fly   106 MSVGNLEEIIDDNH---------------------AIVSTSVGSEHYVSILSFVDKDQLEPGCSV 149
            ..|||:.||::.|.                     .::.||.....::.::..||.|.|:||..|
plant    72 YLVGNIVEILEMNPEDDAEEDGANIDLDSQRKGKCVVLKTSTRQTIFLPVVGLVDPDSLKPGDLV 136

  Fly   150 LLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMG 214
            .:|...:.::..|..:.|..|..|::::.|.|.|.|||||:.||||:.|::.||:||.|.:|::|
plant   137 GVNKDSYLILDTLPSEYDSRVKAMEVDEKPTEDYNDIGGLEKQIQELVEAIVLPMTHKERFEKLG 201

  Fly   215 IKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPS 279
            ::|||||:|||||||||||:|:|.|.||:||||::.|.:|:|.::|||.||||:.|::|:|.||.
plant   202 VRPPKGVLLYGPPGTGKTLMARACAAQTNATFLKLAGPQLVQMFIGDGAKLVRDAFQLAKEKAPC 266

  Fly   280 IVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPG 344
            |:|||||||:||||:||...|:||:||||||||||||||.|...:|||.||||.:.|||||:|.|
plant   267 IIFIDEIDAIGTKRFDSEVSGDREVQRTMLELLNQLDGFSSDERIKVIAATNRADILDPALMRSG 331

  Fly   345 RIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLSELIMAKDDLSGADIKAICTEAGLMALRER 409
            |:|||||||.|.|:.:.||..||:.:|.:..|||..||..:.||.:||.:||:|.|||::|||..
plant   332 RLDRKIEFPHPTEEARARILQIHSRKMNVHPDVNFEELARSTDDFNGAQLKAVCVEAGMLALRRD 396

  Fly   410 RMKVTNEDFKKSKESVLYRKK 430
            ..:|.:|||.:....|..:||
plant   397 ATEVNHEDFNEGIIQVQAKKK 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 182/411 (44%)
RPT5ANP_187204.1 RPT1 29..417 CDD:224143 177/398 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D571919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.