DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and Psmc5

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_112411.1 Gene:Psmc5 / 81827 RGDID:708376 Length:406 Species:Rattus norvegicus


Alignment Length:379 Identity:178/379 - (46%)
Similarity:258/379 - (68%) Gaps:8/379 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LKLLKLERIKDYLMMEDEFIRNQERLKPQ-DEKNEEERSKVDDL-----RGTPMSVGNLEEIIDD 117
            |:...|.:|::..::.::..:|..||:.| :|.|.:.|...::|     :|:  .||.:...:|.
  Rat    20 LRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGS--YVGEVVRAMDK 82

  Fly   118 NHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQET 182
            ...:|......:..|.:...:|.:.:.|.|.|.|.:..:.:..:|.:..||:|::|.:||.|..|
  Rat    83 KKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDST 147

  Fly   183 YADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFL 247
            |..|||||.||:||||.:|||:.|||.:|.:||..||||:|||||||||||||:|||:.|..||:
  Rat   148 YEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFI 212

  Fly   248 RVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELL 312
            ||.||||:||::|:|.::|||||.:|.||||||:|:||||::|:.|.:..|||:.|:||||||||
  Rat   213 RVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELL 277

  Fly   313 NQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDV 377
            ||||||::..::|||||||||:.||.||:||||||||||||.|:|:.:..|..||:.:|.|...:
  Rat   278 NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGI 342

  Fly   378 NLSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKE 431
            ||.::.......|||::|.:|||||:.||||||:.||.|||:.:...|:.:..|
  Rat   343 NLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSE 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 178/379 (47%)
Psmc5NP_112411.1 RPT1 4..404 CDD:224143 178/379 (47%)
May mediate interaction with PRPF9. /evidence=ECO:0000250|UniProtKB:P62196 186..406 123/211 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.