DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and Fggy

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_011238935.1 Gene:Fggy / 75578 MGIID:1922828 Length:560 Species:Mus musculus


Alignment Length:153 Identity:33/153 - (21%)
Similarity:51/153 - (33%) Gaps:41/153 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RSKVDDLRGTPMSVG-NLEEIIDD---------------NHAIVSTSVGSEHYVSIL-------- 135
            ||.:.||....|..| .|.:.:||               ...|:.|...:.|.:|.|        
Mouse   405 RSPLADLTLKGMVTGLTLSQDLDDLAILYLATVQAIAFGTRFIIETMEAAGHSLSTLFLCGGLSK 469

  Fly   136 --SFVDKDQLEPGCSVLLNHKVHAVV-----------GVLSDDTDPMVTVMKLEKAPQETYADIG 187
              .||.......|..|:|:.:|.:|:           |..:...:.|..:.|:.|.....:||..
Mouse   470 NPLFVQMHADITGMPVVLSQEVESVLVGAAILGACASGDFTSVQEAMARMSKVGKVVFPEHADKK 534

  Fly   188 GLDTQIQEIKESVELPLTHPEYY 210
            ..|.:.|.....||    |.:.|
Mouse   535 YYDKKYQVFLRMVE----HQKEY 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 33/153 (22%)
FggyXP_011238935.1 FGGY_YpCarbK_like 19..553 CDD:212663 32/151 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.