DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and Atad2

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_081711.2 Gene:Atad2 / 70472 MGIID:1917722 Length:1364 Species:Mus musculus


Alignment Length:488 Identity:137/488 - (28%)
Similarity:221/488 - (45%) Gaps:126/488 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GQNQSAQGGA------GEKKDDKDKKK------------------KYEPPIPTRVGKKKRRAKGP 42
            |..:|::.|.      ||.:||:|:::                  .|:.|:.:    |.|..:.|
Mouse   238 GSVESSEEGEEQEDDDGEDEDDEDEEEGEEDNQKRYYLRQRKTTVYYQSPLES----KPRHQRKP 298

  Fly    43 DAAMKLPQVTPHTRCRLK--------LLKLERIKDYLMMEDEFIRNQERLKPQDEKNEEERSKV- 98
            :.....|......|.||.        ..::.|.:..:...|....:.......:.:.:..|::. 
Mouse   299 NMFYSGPASPARPRFRLSSTGPRSPYCKRMSRRRHAIHSSDSTSSSSSEDDCFERRTKRNRNRAI 363

  Fly    99 ----------DDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNH 153
                      |::||                                  :.||:::.|.|:.   
Mouse   364 NRCLPLNFRKDEIRG----------------------------------IYKDRMKIGASLA--- 391

  Fly   154 KVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPP 218
                       |.||    |:|:.:.:  :..:|||.:.|..:||.|..||.:||.:|:..|:||
Mouse   392 -----------DVDP----MQLDTSVR--FDSVGGLSSHIAALKEMVVFPLLYPEVFEKFKIQPP 439

  Fly   219 KGVILYGPPGTGKTLLAKAVANQTS------ATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHA 277
            :|.:.||||||||||:|:|:||:.|      |.|:| .|::.:.|::|:..:.:|.||..|.:..
Mouse   440 RGCLFYGPPGTGKTLVARALANECSRGDKRVAFFMR-KGADCLSKWVGESERQLRLLFDQAYQMR 503

  Fly   278 PSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIR 342
            |:|:|.||||.:...|..........|..|:|.|   :||.||||::.||.||||::::||||.|
Mouse   504 PAIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLAL---MDGLDSRGEIVVIGATNRLDSIDPALRR 565

  Fly   343 PGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLSELIMAKDDLS-------GADIKAICTE 400
            |||.||:..|.|||:..::.|..|||      .|.|...:.|..::|:       |||||:||.|
Mouse   566 PGRFDREFLFSLPDKNARKEILKIHT------RDWNPKPVDMFLEELAEHCVGYCGADIKSICAE 624

  Fly   401 AGLMALRER--RMKVTNEDFKKSKESVLYRKKE 431
            |.|.|||.|  ::..|:|..:....|:....|:
Mouse   625 AALCALRRRYPQIYTTSEKLQLDLSSITISAKD 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 137/488 (28%)
Atad2NP_081711.2 AAA 438..579 CDD:214640 64/144 (44%)
AAA 443..577 CDD:278434 60/137 (44%)
Bromo_AAA 960..1070 CDD:99957
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.