DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and PSMC4

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_006494.1 Gene:PSMC4 / 5704 HGNCID:9551 Length:418 Species:Homo sapiens


Alignment Length:399 Identity:195/399 - (48%)
Similarity:290/399 - (72%) Gaps:13/399 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRN-QERLKPQDEKNEEERSKVDDLRGT 104
            ||:     |:.......|.|  ||::..::|.:::|:|:: |:.||.:....:||..::..:   
Human    31 GPE-----PEDLEDLYSRYK--KLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSI--- 85

  Fly   105 PMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPM 169
            |:.:|...|.:|.|.|||.::.||.:||.|||.:|::.|:|..||.|:...:|:|.||..:.|..
Human    86 PLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSS 150

  Fly   170 VTVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLL 234
            :.::..::.|...||||||:|.|.||::|:|||||||.|.|:::||.||:||::|||||.|||:|
Human   151 IMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTML 215

  Fly   235 AKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSG 299
            |||||:.|:|.|:||||||.:|||||:||::||::||:|:|:||:|:|||||||:.|||:|:.:|
Human   216 AKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTG 280

  Fly   300 GEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIF 364
            .:||:||.:||||||:||||...:|||||||||.:||||||:||||:||||||||||.:.||.||
Human   281 ADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIF 345

  Fly   365 TIHTSRMTLAEDVNLSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRK 429
            :..||:|.|:|:|:|.:.:...|.:|||||.:||.|:|::|:||.|..|..:||:|:.::|:  |
Human   346 STITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVI--K 408

  Fly   430 KEGTPEGLY 438
            |:......|
Human   409 KDEQEHEFY 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 195/399 (49%)
PSMC4NP_006494.1 PTZ00454 34..418 CDD:240423 193/391 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.