DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and PSMC2

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_002794.1 Gene:PSMC2 / 5701 HGNCID:9548 Length:433 Species:Homo sapiens


Alignment Length:459 Identity:180/459 - (39%)
Similarity:266/459 - (57%) Gaps:71/459 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GAGEKKDDKDKKKKYEPPIPTRVGKKKRRA--KGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLM 72
            ||.::|..:|:|.  :.||         ||  :|..|.:|....:.::|         :||   .
Human     6 GADQRKTKEDEKD--DKPI---------RALDEGDIALLKTYGQSTYSR---------QIK---Q 47

  Fly    73 MEDEFIRNQERLKPQDEKNEEERSKVDDLRG--------------------------TPMSVGNL 111
            :||:.   |:.||           |:::|.|                          .|:.|...
Human    48 VEDDI---QQLLK-----------KINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARC 98

  Fly   112 EEII----DDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVTV 172
            .:||    :|...|::....::..|.:...|....:|.|..|.::...:.:...|....||.||:
Human    99 TKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTM 163

  Fly   173 MKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKA 237
            |::|:.|..||:|:||...||::::|.||.||.|||.:..:||:|||||:|:|||||||||.|:|
Human   164 MQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARA 228

  Fly   238 VANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGER 302
            |||:|.|.|:||:||||:|||:|:|.::|||||.:|......::|.|||||:|..|:|..:||:.
Human   229 VANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDN 293

  Fly   303 EIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIH 367
            |:|||||||:|||||||.||::||:|||||.:||||||:||||:||||||.|||.:.:..||.||
Human   294 EVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIH 358

  Fly   368 TSRMTLAEDVNLSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVL--YRKK 430
            ...|::..|:....|.....:.:||:|:::|||||:.|:|.||...|.:||.::...|:  |.|.
Human   359 ARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSYAKF 423

  Fly   431 EGTP 434
            ..||
Human   424 SATP 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 180/459 (39%)
PSMC2NP_002794.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 5/17 (29%)
RPT1 23..430 CDD:224143 173/431 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.