DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and katna1

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001018440.1 Gene:katna1 / 553631 ZFINID:ZDB-GENE-050522-514 Length:485 Species:Danio rerio


Alignment Length:440 Identity:139/440 - (31%)
Similarity:194/440 - (44%) Gaps:117/440 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KKYEPPIPTRVGKKKRRAKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQERLKP 86
            :|...|.....|...|.:.||..     |..|..|                     :.|.::.||
Zfish   109 RKSSVPYKDSKGHGNRLSVGPRG-----QARPSPR---------------------VANGDKGKP 147

  Fly    87 QDEKNEEER-SKVDDLRGTPMSVGNLEEIIDDNHA-IVSTSV-----GSEHYVSILSFVDKDQLE 144
            |..|.::|. ||..:               |.|.| .|.|.|     |.|         |||   
Zfish   148 QKSKEKKENPSKPKE---------------DKNKAEAVETEVKRFDRGGE---------DKD--- 185

  Fly   145 PGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEY 209
                         ::..|..|.        :.:.|..|:.||..|:...:.:||:|.||:..||:
Zfish   186 -------------LIDALERDI--------ISQNPNVTWDDIADLEEAKKLLKEAVVLPMWMPEF 229

  Fly   210 YEEMGIKPP-KGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVA 273
            ::  ||:.| |||::.|||||||||||||||.:...||..|..|.|..||.|:..||||.||.:|
Zfish   230 FK--GIRRPWKGVLMVGPPGTGKTLLAKAVATECRTTFFNVSSSTLTSKYRGESEKLVRLLFEMA 292

  Fly   274 EEHAPSIVFIDEIDAVGTKRYDSNSGGEREI-QRTMLELLNQLDGFDSRGD------VKVIMATN 331
            ..:||:.:||||||::.::|..|.   |.|. :|...|||.|:||.....:      |.|:.|||
Zfish   293 RFYAPTTIFIDEIDSICSRRGTSE---EHEASRRVKAELLVQMDGVGGTSENDPSKMVMVLAATN 354

  Fly   332 RIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLSELIMAKDDLSGADIKA 396
            ....:|.||.|  |::::|..|||..|.:..:..|:...:.||.|||:.::....:..|||||..
Zfish   355 FPWDIDEALRR--RLEKRIYIPLPSAKGRVDLLKINLKELDLANDVNMDKIAEQMEGYSGADITN 417

  Fly   397 ICTEAGLMALRER-----------------RMKVTNEDF----KKSKESV 425
            :|.:|.|||:|.|                 .|..|.|||    ||..:||
Zfish   418 VCRDASLMAMRRRIEGLTPEEIRNLPKDEMHMPTTMEDFETALKKVSKSV 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 139/440 (32%)
katna1NP_001018440.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..173 21/104 (20%)
SpoVK <184..478 CDD:223540 113/315 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.