DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and FGGY

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001106882.1 Gene:FGGY / 55277 HGNCID:25610 Length:575 Species:Homo sapiens


Alignment Length:167 Identity:39/167 - (23%)
Similarity:64/167 - (38%) Gaps:43/167 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 EPGCSV---LLNHKV--HAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKE----- 198
            |.|.||   |::|.|  ||....|.         :|.....|..||   .|::.:..||:     
Human   328 EGGQSVTGKLIDHMVQGHAAFPELQ---------VKATARCQSIYA---YLNSHLDLIKKAQPVG 380

  Fly   199 --SVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFL--RVVGSELIQK-- 257
              :|:|.: .|:::...  .|...:.|.|...||...:....|..:.::.|  :|.|.:|.|.  
Human   381 FLTVDLHV-WPDFHGNR--SPLADLTLKGMRTTGYLYIPALAALHSPSSLLSPQVTGLKLSQDLD 442

  Fly   258 -----YLGD------GPKLVRELFRVAEEHAPSIVFI 283
                 ||..      |.:.:.|....| .|:.|.:|:
Human   443 DLAILYLATVQAIALGTRFIIEAMEAA-GHSISTLFL 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 39/167 (23%)
FGGYNP_001106882.1 FGGY_YpCarbK_like 10..568 CDD:212663 39/167 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.