DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and Kat60

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster


Alignment Length:352 Identity:113/352 - (32%)
Similarity:181/352 - (51%) Gaps:59/352 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 GTPMSVGNLEEIIDDNHAIVSTSVGS--------EHYVSILSFVDKDQLEPGCSVLLNHKVHAVV 159
            |..:|..|..|..||:    ||:.|:        |:.....:..::.:.:|.     ||....:|
  Fly   254 GRKLSTSNTNEARDDD----STAAGNNGGAAGDGENGDPQAAQEEERKFQPN-----NHIEAELV 309

  Fly   160 GVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPP-KGVIL 223
            .:|..|.        |:|.|:..::||..|....:.::|:|.||:..|:|::  ||:.| |||::
  Fly   310 DILERDI--------LQKDPKVRWSDIADLHDAKRLLEEAVVLPMLMPDYFK--GIRRPWKGVLM 364

  Fly   224 YGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDA 288
            .||||||||:||||||.:...||..|..:.|..||.|:..|:||.||.:|..:|||.:||||||:
  Fly   365 VGPPGTGKTMLAKAVATECGTTFFNVSSATLTSKYRGESEKMVRLLFEMARFYAPSTIFIDEIDS 429

  Fly   289 VGTKRYDSNSGGERE---IQRTMLELLNQLDGFDSRGD----VKVIMATNRIETLDPALIRPGRI 346
            :.::|     |.|.|   .:|...|||.|:||.....:    |.|:.|||....:|.||.|  |:
  Fly   430 LCSRR-----GSESEHEASRRVKSELLVQMDGVGGGEEQAKVVMVLAATNFPWDIDEALRR--RL 487

  Fly   347 DRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLSELIMAKDDLSGADIKAICTEAGLMALR---- 407
            :::|..|||.::.:..:..|:...:.:.:.|:|:.:.......|||||..:|.||.:|::|    
  Fly   488 EKRIYIPLPSDEGREALLKINLREVKVDDSVDLTYVANELKGYSGADITNVCREASMMSMRRKIA 552

  Fly   408 -------------ERRMKVTNEDFKKS 421
                         |..:.|:|:||.::
  Fly   553 GLTPEQIRQLATEEVDLPVSNKDFNEA 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 113/352 (32%)
Kat60NP_001262276.1 HCV_NS5a_C <163..243 CDD:289693
P-loop_NTPase 325..>381 CDD:304359 28/57 (49%)
AAA 358..496 CDD:214640 63/144 (44%)
AAA 362..495 CDD:278434 59/139 (42%)
Vps4_C <570..603 CDD:286426 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.