DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and psmc5

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001003740.1 Gene:psmc5 / 445285 ZFINID:ZDB-GENE-030131-6547 Length:406 Species:Danio rerio


Alignment Length:379 Identity:179/379 - (47%)
Similarity:257/379 - (67%) Gaps:8/379 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LKLLKLERIKDYLMMEDEFIRNQERLKPQ-DEKNEEERSKVDDL-----RGTPMSVGNLEEIIDD 117
            |:...|.:|::..:..:|..:|..||:.| :|.|.:.|...::|     :|:  .||.:...:|.
Zfish    20 LRQYYLSKIEELQLTVNEKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGS--YVGEVVRAMDK 82

  Fly   118 NHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQET 182
            ...:|......:..|.:...:|.:.:.|.|.|.|.:..:.:..:|.:..||:|::|.:||.|..|
Zfish    83 KKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDST 147

  Fly   183 YADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFL 247
            |..|||||.||:||||.:|||:.|||.:|.:||..||||:|||||||||||||:|||:.|..||:
Zfish   148 YEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFI 212

  Fly   248 RVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELL 312
            ||.||||:||::|:|.::|||||.:|.||||||:|:||||::|:.|.:..|||:.|:||||||||
Zfish   213 RVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELL 277

  Fly   313 NQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDV 377
            ||||||::..::|||||||||:.||.||:||||||||||||.|:|:.:..|..||:.:|.|...:
Zfish   278 NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGI 342

  Fly   378 NLSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKE 431
            ||.::.......|||::|.:|||||:.||||||:.||.|||:.:...|:.:..|
Zfish   343 NLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSE 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 179/379 (47%)
psmc5NP_001003740.1 RPT1 4..404 CDD:224143 179/379 (47%)
AAA_16 153..>206 CDD:289934 38/52 (73%)
AAA 186..318 CDD:278434 90/131 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.