DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and Rpt5

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_524464.1 Gene:Rpt5 / 42805 FlyBaseID:FBgn0028684 Length:428 Species:Drosophila melanogaster


Alignment Length:405 Identity:182/405 - (44%)
Similarity:262/405 - (64%) Gaps:28/405 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 MKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQERLKPQDEKNEEERSKVDDLRGTPMSVGN 110
            |...::...||.....:|:        |:.|.||....::.|:||.::...|:...:..|..|.|
  Fly    25 MSTDEIVSRTRLMDNEIKI--------MKSEVIRITHEIQAQNEKIKDNTEKIKVNKTLPYLVSN 81

  Fly   111 LEEIID---------------DNH-----AIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKV 155
            :.|::|               ||.     |::.||....:::.::..||.::|:||..|.:|...
  Fly    82 VIELLDVDPQEEEDDGSVTVLDNQRKGKCAVIKTSTRQAYFLPVIGLVDAEKLKPGDLVGVNKDS 146

  Fly   156 HAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKG 220
            :.::..|..:.|..|..|::::.|.|.|:||||||.||||:.|:|.||:||.|.::.:||.||||
  Fly   147 YLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEKFKNLGIHPPKG 211

  Fly   221 VILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDE 285
            |:|||||||||||||:|.|.||.:|||::.|.:|:|.::|||.||||:.|.:|:|.||:|:||||
  Fly   212 VLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDE 276

  Fly   286 IDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKI 350
            :||:||||:||...|:||:||||||||||||||.|..|:|||.||||::.|||||:|.||:||||
  Fly   277 LDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKI 341

  Fly   351 EFPLPDEKTKRRIFTIHTSRMTLAEDVNLSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTN 415
            |||.|:|:.:.||..||:.:|.::.|||..||..:.||.:||..||:|.|||::|||.....||:
  Fly   342 EFPHPNEEARARIMQIHSRKMNVSNDVNFEELSRSTDDFNGAQCKAVCVEAGMIALRRSANSVTH 406

  Fly   416 EDFKKSKESVLYRKK 430
            |||..:...|..:||
  Fly   407 EDFMDAIMEVQAKKK 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 182/405 (45%)
Rpt5NP_524464.1 RPT1 33..421 CDD:224143 179/395 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445418
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.