DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and psmc5

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_989358.1 Gene:psmc5 / 394988 XenbaseID:XB-GENE-999928 Length:414 Species:Xenopus tropicalis


Alignment Length:379 Identity:180/379 - (47%)
Similarity:258/379 - (68%) Gaps:8/379 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LKLLKLERIKDYLMMEDEFIRNQERLKPQ-DEKNEEERSKVDDL-----RGTPMSVGNLEEIIDD 117
            |:...|.:|:|..::.::..:|..||:.| :|.|.:.|...::|     :|:  .||.:...:|.
 Frog    28 LRQYYLSKIEDLQLVVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGS--YVGEVVRAMDK 90

  Fly   118 NHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQET 182
            ...:|......:..|.|...:|.:.:.|.|.|.|.:..:.:..:|.:..||:|::|.:||.|..|
 Frog    91 KKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDST 155

  Fly   183 YADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFL 247
            |..|||||.||:||||.:|||:.|||.:|.:||..||||:|||||||||||||:|||:.|..||:
 Frog   156 YEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFI 220

  Fly   248 RVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELL 312
            ||.||||:||::|:|.::|||||.:|.||||||:|:||||::|:.|.:..|||:.|:||||||||
 Frog   221 RVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELL 285

  Fly   313 NQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDV 377
            ||||||::..::|||||||||:.||.||:||||||||||||.|:|:.:..|..||:.:|.|...:
 Frog   286 NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGI 350

  Fly   378 NLSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKE 431
            ||.::.......|||::|.:|||||:.||||||:.||.|||:.:...|:.:..|
 Frog   351 NLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSE 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 180/379 (47%)
psmc5NP_989358.1 RPT1 15..412 CDD:224143 180/379 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.