DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and psmc6

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_989342.1 Gene:psmc6 / 394968 XenbaseID:XB-GENE-978099 Length:389 Species:Xenopus tropicalis


Alignment Length:373 Identity:157/373 - (42%)
Similarity:235/373 - (63%) Gaps:6/373 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RLKLLKLERIKDYLMMEDEFIRNQERLKPQDEKNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIV 122
            |.|||:.:.|...|.      ..:|:||...::.|:..:.:..|:.....||.:.:.:.:...||
 Frog    13 RKKLLEHKEIDGRLK------ELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIV 71

  Fly   123 STSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIG 187
            ..:.|..:.|.....:||.:|:||..|.|:.....::..|..:.||:|..|..|.....:|::||
 Frog    72 KATNGPRYVVGCRRQLDKTKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIG 136

  Fly   188 GLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGS 252
            ||..||:|::|.:|||||:||.::.:||.||||.:|||||||||||||:|||:|....||:||.|
 Frog   137 GLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSS 201

  Fly   253 ELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDG 317
            .::.||:|:..:|:||:|..|.:|.|.|:|:|||||:|.:|:...:..:||||||::|||||:||
 Frog   202 SIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDG 266

  Fly   318 FDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLSEL 382
            ||:...||:||||||.:||||||:||||:||||...||:|:.:..|..||...:|...:::...:
 Frog   267 FDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHAGPITKHGEIDYEAI 331

  Fly   383 IMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKK 430
            :...|..:|||::.:|||||:.|:|..|..|..|||.|:...|...||
 Frog   332 VKLSDGFNGADLRNVCTEAGMFAIRADRDFVVQEDFMKAVRKVADSKK 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 157/373 (42%)
psmc6NP_989342.1 RPT1 4..387 CDD:224143 157/373 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.