DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and Atad2

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001128351.1 Gene:Atad2 / 314993 RGDID:1304849 Length:1373 Species:Rattus norvegicus


Alignment Length:486 Identity:138/486 - (28%)
Similarity:217/486 - (44%) Gaps:128/486 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GQNQSAQGGAGEKKD-------DKDKKKK-----------YEPPIPTRVGKKKRRAKGPDAAMKL 48
            |:.|....|..|:.|       ::|.:|:           |:.|:     :|.|..:.|:.....
  Rat   250 GEEQEDDDGEDEEDDEDEEEDGEEDNQKRYYLRQRKATVYYQAPL-----EKPRHQRKPNMFYSG 309

  Fly    49 PQVTPHTRCRLK--------LLKLERIKDYLMMEDEFIRNQERLKPQDEKNEEERS--------- 96
            |......|.||.        ..::.|.:..:...|.   .......:||..|..|.         
  Rat   310 PASPARPRYRLSSSGPRSPYCKRMNRRRHAIHSSDS---TSSSSSSEDECFERRRKRNRNRAINR 371

  Fly    97 ------KVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKV 155
                  :.|::||                                  :.||:::.|.::.     
  Rat   372 CLPLNFRKDEIRG----------------------------------IYKDRMKIGANLA----- 397

  Fly   156 HAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKG 220
                     |.||    |:|:.:.:  :..:|||.:.|..:||.|..||.:||.:|:..|:||:|
  Rat   398 ---------DVDP----MQLDSSVR--FDSVGGLSSHIAALKEMVLFPLLYPEVFEKFKIQPPRG 447

  Fly   221 VILYGPPGTGKTLLAKAVANQTS------ATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPS 279
            .:.||||||||||:|:|:||:.|      |.|:| .|::.:.|::|:..:.:|.||..|.:..|:
  Rat   448 CLFYGPPGTGKTLVARALANECSRGDKRVAFFMR-KGADCLSKWVGESERQLRLLFDQAYQMRPA 511

  Fly   280 IVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPG 344
            |:|.||||.:...|..........|..|:|.|   :||.||||::.||.||||::::||||.|||
  Rat   512 IIFFDEIDGLAPVRSSRQDQIHSSIVSTLLAL---MDGLDSRGEIVVIGATNRLDSIDPALRRPG 573

  Fly   345 RIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLSELIMAKDDLS-------GADIKAICTEAG 402
            |.||:..|.|||:..::.|..|||      .|.|...:.|..::|:       |||||:||.||.
  Rat   574 RFDREFLFSLPDKDARKEILKIHT------RDWNPKPVDMFLEELAENCVGYCGADIKSICAEAA 632

  Fly   403 LMALRER--RMKVTNEDFKKSKESVLYRKKE 431
            |.|||.|  ::..|:|..:....|:....|:
  Rat   633 LCALRRRYPQIYTTSEKLQLDLSSINISAKD 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 138/486 (28%)
Atad2NP_001128351.1 AAA 444..585 CDD:214640 64/144 (44%)
AAA 449..583 CDD:278434 60/137 (44%)
Bromo_AAA 972..1082 CDD:99957
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.