DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and CG10793

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_570054.2 Gene:CG10793 / 31308 FlyBaseID:FBgn0029656 Length:479 Species:Drosophila melanogaster


Alignment Length:407 Identity:106/407 - (26%)
Similarity:176/407 - (43%) Gaps:93/407 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KKYEPPIPTRVGKKKRRAKGPDAAMKLPQVTPHTRCRL-----------KLLKLERIKDYLMMED 75
            ||....|...:|..|...|.|  |.:||:..|.|...|           :.|..|:......||.
  Fly    93 KKVGAKIKVEMGGGKAHEKTP--AKELPKKPPTTDASLANWHIGVGAATQALSNEQPLQIKKMET 155

  Fly    76 EFIRNQERLKPQDEKNEEERSKV--DDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFV 138
            ....|     .||...|.|...:  ||:..:.:...:|.|       :|.||:..|         
  Fly   156 ATESN-----GQDNACEIEHVHLGGDDVLFSSLEWQSLAE-------LVKTSILQE--------- 199

  Fly   139 DKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVELP 203
                         |.|:                          .::|:.|....|:.|||:|..|
  Fly   200 -------------NIKI--------------------------KWSDVCGNQRAIELIKEAVLTP 225

  Fly   204 LTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQT--SATFLRVVGSELIQKYLGDGPKLV 266
            :..|:.:.. |:||.:.::|:||||:||||||||:.::|  ..||..:..|.::.|:.|:..|::
  Fly   226 IEFPQLFAH-GLKPWRSLLLHGPPGSGKTLLAKALYSETQGQVTFFNITASIMVSKWRGESEKIL 289

  Fly   267 RELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFD-SRGDVKVIMAT 330
            |.||.:|.:.|||::|.|||:::.:||  ..:......:|...|||..|||.: |...|.|:.:|
  Fly   290 RVLFHMAAKRAPSVIFFDEIESLTSKR--DRATDHESSKRFKNELLQLLDGMEHSLNGVFVLAST 352

  Fly   331 NRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLS-----ELIMAKDDLS 390
            |....:|.|.:|  |.::|:...||:...:..:.    :|: |...::|:     :|:...|..:
  Fly   353 NLPWDIDEAFLR--RFEKKLLVQLPNAAERSCLI----NRL-LGSSISLNPRLLEQLVEISDHFT 410

  Fly   391 GADIKAICTEAGLMALR 407
            |.:|:..|.|..:..:|
  Fly   411 GDEIRLACKEISMHRVR 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 106/407 (26%)
CG10793NP_570054.2 LisH 31..56 CDD:285685
P-loop_NTPase 205..>259 CDD:304359 24/54 (44%)
AAA 238..376 CDD:214640 52/141 (37%)
AAA 242..374 CDD:278434 50/135 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.