DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and Gykl1

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_599168.1 Gene:Gykl1 / 291468 RGDID:1305596 Length:549 Species:Rattus norvegicus


Alignment Length:329 Identity:62/329 - (18%)
Similarity:100/329 - (30%) Gaps:125/329 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 PKGVI--LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDG-----PKLVRE-----LF 270
            ||.|:  |.|....|.:.....|.|..:|..|.....|:.|::..:|     ||::.:     :.
  Rat     5 PKAVLGPLVGAVDQGTSSTRFLVFNPQTAELLCHHQVEIAQEFPREGWVEQDPKVILQSVYECIE 69

  Fly   271 RVAEEHAPSIVFIDEIDAVG-------TKRYDSNSGG---------EREIQRTMLELLNQLDGFD 319
            :..|:.....:.|..|.|:|       |..:|..:|.         :...|.| :|.||      
  Rat    70 KTCEKLGQQSIDISNIKAIGVTNQRETTIVWDKFTGEPLYNAVVWLDLRTQST-VENLN------ 127

  Fly   320 SRGDVKVIMATNR--------------------------------IE-------TLDPALI--RP 343
                 |.|.|:|.                                ||       |:|..||  ..
  Rat   128 -----KSISASNNFIKIKTGLPISTYFSAVKLHWLIENVKNVQKAIEDGRAFFGTVDSWLIWCMT 187

  Fly   344 GRIDRKIEFPLPDEKTKRRIFTIHTSR------------MTLAEDVNLSELI--MAKD------- 387
            |.|:..:........::..:|.||:.:            ||:...:..|..|  :.|.       
  Rat   188 GGINGGVHCTDVSNASRTMLFNIHSLQWDEELCEFFGIPMTILPRIRSSSEIYGLMKSGVLEGVP 252

  Fly   388 ------DLSGADIKAICTE---------AGLMALRERRMKVTNED--------FKKSKESVLYRK 429
                  |.|.|.:..:|.:         .|...|.....|..|.|        :|..:|..:|..
  Rat   253 ISGCLGDQSAALVGQLCLQDGQAKSTYGTGCFLLCNTGQKCVNSDHGLLTTVAYKMGREEPVYYA 317

  Fly   430 KEGT 433
            .||:
  Rat   318 LEGS 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 62/329 (19%)
Gykl1NP_599168.1 glycerol_kin 11..513 CDD:273549 59/323 (18%)
FGGY_GK1-3_metazoa 11..513 CDD:212664 59/323 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.