DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and ATAD2

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_054828.2 Gene:ATAD2 / 29028 HGNCID:30123 Length:1390 Species:Homo sapiens


Alignment Length:512 Identity:143/512 - (27%)
Similarity:223/512 - (43%) Gaps:155/512 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GQNQSAQGGA-------GEKKDDKD--------------------------------KKKK---- 23
            |..:|::.|.       ||.:||:|                                :::|    
Human   240 GSVESSEEGEDQEHEDDGEDEDDEDDDDDDDDDDDDDDEDDEDEEDGEEENQKRYYLRQRKATVY 304

  Fly    24 YEPPIPTRVGKKKRRAKGPDAAMKLPQVTPHTRCRLK--------LLKLERIKDYLMMEDEFIRN 80
            |:.|:     :|.|..:.|:.....|......|.||.        ..::.|.:..:...|    :
Human   305 YQAPL-----EKPRHQRKPNIFYSGPASPARPRYRLSSAGPRSPYCKRMNRRRHAIHSSD----S 360

  Fly    81 QERLKPQDEKNEEERSK----------------VDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSE 129
            ......:||::.|.|.|                .|:|:|                          
Human   361 TSSSSSEDEQHFERRRKRSRNRAINRCLPLNFRKDELKG-------------------------- 399

  Fly   130 HYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ 194
                    :.||:::.|.|:.              |.||    |:|:.:.:  :..:|||...|.
Human   400 --------IYKDRMKIGASLA--------------DVDP----MQLDSSVR--FDSVGGLSNHIA 436

  Fly   195 EIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTS------ATFLRVVGSE 253
            .:||.|..||.:||.:|:..|:||:|.:.||||||||||:|:|:||:.|      |.|:| .|::
Human   437 ALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDKRVAFFMR-KGAD 500

  Fly   254 LIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF 318
            .:.|::|:..:.:|.||..|.:..|||:|.||||.:...|..........|..|:|.|   :||.
Human   501 CLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLAL---MDGL 562

  Fly   319 DSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLSELI 383
            ||||::.||.||||::::||||.||||.||:..|.|||::.::.|..|||      .|.|...|.
Human   563 DSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDKEARKEILKIHT------RDWNPKPLD 621

  Fly   384 MAKDDLS-------GADIKAICTEAGLMALRER--RMKVTNEDFKKSKESVLYRKKE 431
            ...::|:       |||||:||.||.|.|||.|  ::..|:|..:....|:....|:
Human   622 TFLEELAENCVGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLSSINISAKD 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 143/512 (28%)
ATAD2NP_054828.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..63
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..380 25/148 (17%)
AAA 459..600 CDD:214640 65/144 (45%)
AAA 464..598 CDD:278434 61/137 (45%)
COG5076 <915..1153 CDD:227408
Bromo_AAA 987..1097 CDD:99957
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1124..1163
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1181..1242
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.