DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and Psmc6

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001093979.1 Gene:Psmc6 / 289990 RGDID:1308825 Length:403 Species:Rattus norvegicus


Alignment Length:395 Identity:162/395 - (41%)
Similarity:247/395 - (62%) Gaps:12/395 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 MKLPQVTPHTRCRLKLLKLER---IKDY--LMMEDEFIRN-----QERLKPQDEKNEEERSKVDD 100
            |.||.: |:.| ||.::...|   ::||  .::|.:.|..     :|:||...::.|:..:.:..
  Rat     1 MALPGI-PYER-RLLIMADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKA 63

  Fly   101 LRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDD 165
            |:.....||.:.:.:.:...||..:.|..:.|.....:||.:|:||..|.|:.....::..|..:
  Rat    64 LQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPRE 128

  Fly   166 TDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTG 230
            .||:|..|..|.....:|::||||..||:|::|.:|||||:||.::.:||.||||.:||||||||
  Rat   129 VDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTG 193

  Fly   231 KTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYD 295
            |||||:|||:|....||:||.|.::.||:|:..:|:||:|..|.:|.|.|:|:|||||:|.:|:.
  Rat   194 KTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFS 258

  Fly   296 SNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTK 360
            ..:..:||||||::|||||:||||:...||:||||||.:||||||:||||:||||...||:|:.:
  Rat   259 EGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQAR 323

  Fly   361 RRIFTIHTSRMTLAEDVNLSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESV 425
            ..|..||...:|...:::...::...|..:|||::.:|||||:.|:|.....|..|||.|:...|
  Rat   324 LDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKV 388

  Fly   426 LYRKK 430
            ...||
  Rat   389 ADSKK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 162/395 (41%)
Psmc6NP_001093979.1 RPT1 18..401 CDD:224143 155/376 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.