DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and Gk

DIOPT Version :10

Sequence 1:NP_524469.2 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_006527892.1 Gene:Gk / 14933 MGIID:106594 Length:587 Species:Mus musculus


Alignment Length:95 Identity:20/95 - (21%)
Similarity:37/95 - (38%) Gaps:33/95 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 DLRGTPMSVGNLEEIIDDNHAIVSTSVG---SEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGV 161
            ||| |..:|.||.:.|..|:..|.:..|   |.::.::                   |:..::. 
Mouse   144 DLR-TQSTVENLSKRIPGNNNFVKSKTGLPLSTYFSAV-------------------KLRWLLD- 187

  Fly   162 LSDDTDPMVTVMKLEKAPQETYADIGGLDT 191
                     .|.|:::|.:|..|..|.:|:
Mouse   188 ---------NVKKVQEAVEENRALFGTIDS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_524469.2 PTZ00361 1..439 CDD:185575 20/95 (21%)
GkXP_006527892.1 ASKHA_NBD_FGGY_GK1-3-like 11..544 CDD:466802 20/95 (21%)

Return to query results.
Submit another query.