DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and Gk2

DIOPT Version :10

Sequence 1:NP_524469.2 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_034424.1 Gene:Gk2 / 14626 MGIID:1329027 Length:554 Species:Mus musculus


Alignment Length:152 Identity:35/152 - (23%)
Similarity:55/152 - (36%) Gaps:49/152 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 LAKAVANQTSATFLRVVGS-----------ELIQKYLGDG-----PK-LVRELF----RVAEEHA 277
            |..||...|::|...|..|           ||.|:|..:|     || :::.::    :..|:.|
Mouse    12 LVGAVVQGTNSTRFLVFNSKTAELVCSHQVELTQEYPKEGWVEQDPKEILKSVYECIAKACEKLA 76

  Fly   278 PSIVFIDEIDAVG-------TKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIET 335
            ...:.|..|.|:|       |..:|..:|.         .|.|.:...|.|       ..:.:||
Mouse    77 EVNIDISNIKAIGVSNQRETTVVWDKFTGD---------PLYNAVVWLDLR-------TQSTVET 125

  Fly   336 LDPALIRPGR---IDRKIEFPL 354
            |...:  ||.   :..|...||
Mouse   126 LTKKI--PGNSNFVKSKTGLPL 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_524469.2 PTZ00361 1..439 CDD:185575 35/152 (23%)
Gk2NP_034424.1 ASKHA_NBD_FGGY_GK1-3-like 11..510 CDD:466802 35/152 (23%)

Return to query results.
Submit another query.