DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt2 and shpk

DIOPT Version :9

Sequence 1:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_001341627.4 Gene:shpk / 100001676 ZFINID:ZDB-GENE-060526-357 Length:469 Species:Danio rerio


Alignment Length:143 Identity:32/143 - (22%)
Similarity:42/143 - (29%) Gaps:31/143 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 HAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKG 220
            |..||....|....|            |:.|......:..:..|.:|....|..:.......|..
Zfish   247 HTAVGAALGDFQCSV------------YSCITDRGHAVLNMSTSAQLTFRMPAEFTPTSSPDPLS 299

  Fly   221 VILYGPPGTGKTLLAKAVAN--QTSATFLRV----------------VGSELIQKYLGD-GPKLV 266
            .|.|.|...|..|...|..|  ...|||:|:                :.|:||...|.. ...|.
Zfish   300 PIAYFPYFEGSYLAVAASLNGGNVMATFVRMLDSWMKEFGLEVSESSIYSQLIHSALAQPNTDLT 364

  Fly   267 RELFRVAEEHAPS 279
            .....:.|.||||
Zfish   365 VTSTLLGERHAPS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 32/143 (22%)
shpkXP_001341627.4 FGGY_SHK_like 11..464 CDD:212661 32/143 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.