DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment tbrd-1 and BAZ1B

DIOPT Version :9

Sequence 1:	NP_001369030.1	Gene:	tbrd-1 / 42823	FlyBaseID:	FBgn0039124	Length:	513	Species:	Drosophila melanogaster
Sequence 2:	NP_001357331.1	Gene:	BAZ1B / 9031	HGNCID:	961	Length:	1483	Species:	Homo sapiens

Alignment Length:	116	Identity:	37/116 - (31%)
Similarity:	59/116 - (50%)	Gaps:	7/116 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly    14 RNEPYLQPVNGIVQPPVIPPPNRPGRRTNI-LEELKSVLNCLWRNRFSYHFRHPV--DSVSLGVP 75
            |::|...||:......::....|..||.:: |::.:.:|:.:.:.|||:.||.||  |...
Human  1314 RSQPKAPPVDDAEVDELVLQTKRSSRRQSLELQKCEEILHKIVKYRFSWPFREPVTRDEAE---- 1374

  Fly    76 DYHAVVKHPMDLSTIRKRLHNKYYWQASEALEDFKLIFDNCLLYNLEGSPV 126
            ||:.|:.||||..|::.:.....|....|.|.|.|.:|.|..:||..||.|
Human  1375 DYYDVITHPMDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHV 1425

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
tbrd-1	NP_001369030.1	Bromodomain	39..143	CDD:413371	32/91 (35%)
tbrd-1	NP_001369030.1	Bromodomain	328..423	CDD:413371
BAZ1B	NP_001357331.1	WAC_Acf1_DNA_bd	21..120	CDD:337781
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	145..212
		C motif	207..213
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	302..333
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	379..432
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	446..470
		DDT	604..668	CDD:214726
		DUF5401	<664..>877	CDD:340095
		WHIM1	727..767	CDD:339506
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	788..817
		WSD	898..1025	CDD:317927
		PHD_BAZ1B	1186..1231	CDD:277098
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1237..1326		4/11 (36%)
		Bromo_WSTF_like	1344..1440	CDD:99937	30/86 (35%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1455..1483
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5076
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810