Sequence 1: | NP_001369030.1 | Gene: | tbrd-1 / 42823 | FlyBaseID: | FBgn0039124 | Length: | 513 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_012933.4 | Gene: | RSC4 / 853877 | SGDID: | S000001716 | Length: | 625 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 266 | Identity: | 47/266 - (17%) |
---|---|---|---|
Similarity: | 97/266 - (36%) | Gaps: | 81/266 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 RFSYHFRHPVDSVSLGVPDYHAVVKHPMDLSTIRKRLHNKYYWQASEALEDFKLIFDNCLLYNLE 122
Fly 123 GSPVYQAGK--------LLMEAFYMRMESIDLSTEV----------------------------- 150
Fly 151 ----ELKPKSEKRKRKATESLDQASTSFS-APRASNNYSRQWLSSSSSWLCPPPMPGGVSSFNP- 209
Fly 210 SFRNFVG-PSLIPSFMPD--------SLVNPMQSMH---PMSSMMNPIFKNNWETNEAMDPPPSE 262
Fly 263 PISYRP 268 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tbrd-1 | NP_001369030.1 | Bromodomain | 39..143 | CDD:413371 | 22/92 (24%) |
Bromodomain | 328..423 | CDD:413371 | |||
RSC4 | NP_012933.4 | COG5076 | 40..423 | CDD:227408 | 42/234 (18%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5076 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |