DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-1 and RSC4

DIOPT Version :9

Sequence 1:NP_001369030.1 Gene:tbrd-1 / 42823 FlyBaseID:FBgn0039124 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_012933.4 Gene:RSC4 / 853877 SGDID:S000001716 Length:625 Species:Saccharomyces cerevisiae


Alignment Length:266 Identity:47/266 - (17%)
Similarity:97/266 - (36%) Gaps:81/266 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RFSYHFRHPVDSVSLGVPDYHAVVKHPMDLSTIRKRLHNKYYWQASEALEDFKLIFDNCLLYNLE 122
            :.|..|...||...|  |:|:.:|..||.||.:::.|....|.:..:.:.|..|:|.|..::|..
Yeast   208 KLSEPFMELVDKDEL--PEYYEIVHSPMALSIVKQNLEIGQYSKIYDFIIDMLLVFQNAHIFNDP 270

  Fly   123 GSPVYQAGK--------LLMEAFYMRMESIDLSTEV----------------------------- 150
            .:.:|:...        |:.:.|:..::.::...|:                             
Yeast   271 SALIYKDATTLTNYFNYLIQKEFFPELQDLNERGEINLEFDKFEFENYLAIGGGGPAAAGALAIS 335

  Fly   151 ----ELKPKSEKRKRKATESLDQASTSFS-APRASNNYSRQWLSSSSSWLCPPPMPGGVSSFNP- 209
                :::|:|.:.     :.:|||...|: .....|.|:|..|  :..:|           .|| 
Yeast   336 ALDNDIEPESNRE-----DLIDQADYDFNHFEGLGNGYNRSLL--TEDYL-----------LNPN 382

  Fly   210 SFRNFVG-PSLIPSFMPD--------SLVNPMQSMH---PMSSMMNPIFKNNWETNEAMDPPPSE 262
            :|:..:. |..:.|.:.:        ...|.::|.|   |..:::..:.|.....:|      ..
Yeast   383 NFKKLIAKPETVQSEVKNERSTTSDIEKTNSLESEHLKIPKYNVIKSMQKEMQSLSE------QH 441

  Fly   263 PISYRP 268
            .:.|:|
Yeast   442 TMEYKP 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-1NP_001369030.1 Bromodomain 39..143 CDD:413371 22/92 (24%)
Bromodomain 328..423 CDD:413371
RSC4NP_012933.4 COG5076 40..423 CDD:227408 42/234 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.