DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-1 and GTE3

DIOPT Version :9

Sequence 1:NP_001369030.1 Gene:tbrd-1 / 42823 FlyBaseID:FBgn0039124 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_177458.1 Gene:GTE3 / 843646 AraportID:AT1G73150 Length:461 Species:Arabidopsis thaliana


Alignment Length:245 Identity:72/245 - (29%)
Similarity:115/245 - (46%) Gaps:45/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELQSNSNQPPPRNEPYLQPVNGIVQPPVIPPPNRPGRR------------TNILEELKSVLNCLW 55
            |.|.|:..|.|..:  |:..||             |::            ..||:...::|..|.
plant    82 EPQGNNFAPVPNKK--LKTANG-------------GKKGGVHGAAADKGTVQILKSCNNLLTKLM 131

  Fly    56 RNRFSYHFRHPVDSVSLGVPDYHAVVKHPMDLSTIRKRLHNKYYWQASEALEDFKLIFDNCLLYN 120
            :::..:.|..|||.|:||:.|||.::|.||||.|::.||....|....|..||.:|.|:|.:|||
plant   132 KHKSGWIFNTPVDVVTLGLHDYHNIIKEPMDLGTVKTRLSKSLYKSPLEFAEDVRLTFNNAMLYN 196

  Fly   121 LEGSPVYQAGKLLMEAFYMRMESIDLSTEVELKPKSEKRKRKATESLDQASTSFSAPRASNNYSR 185
            ..|..||...::|:..|..:.  :.|.|:.||.    .||::....:|     |.||.::|.::.
plant   197 PVGHDVYHMAEILLNLFEEKW--VPLETQYELL----IRKQQPVRDID-----FHAPVSTNTHNV 250

  Fly   186 QW--LSSSSSWLCPPPMPGGVSSFN----PSFRNFVGPSLIPSFMPDSLV 229
            :.  |.:.:..|.|||.|..|.:..    .|..|.|.|:::| .:|:.||
plant   251 EALPLPAPTPSLSPPPPPKVVENRTLERAESMTNPVKPAVLP-VVPEKLV 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-1NP_001369030.1 Bromodomain 39..143 CDD:413371 37/115 (32%)
Bromodomain 328..423 CDD:413371
GTE3NP_177458.1 Bromo_plant1 120..217 CDD:99938 36/96 (38%)
BET 308..370 CDD:407211
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000322
OrthoInspector 1 1.000 - - mtm8402
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.