DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-1 and BET10

DIOPT Version :9

Sequence 1:NP_001369030.1 Gene:tbrd-1 / 42823 FlyBaseID:FBgn0039124 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_566151.1 Gene:BET10 / 821083 AraportID:AT3G01770 Length:620 Species:Arabidopsis thaliana


Alignment Length:139 Identity:42/139 - (30%)
Similarity:73/139 - (52%) Gaps:17/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LEELKSVLNCLWRNRFSYHFRHPVDSVSLGVPDYHAVVKHPMDLSTIRKRLHNKYYWQASEALED 108
            :::.:|:|..|...:..:.|..|||.|.|.:|||..::||||||.|::.:|.:..|...||...|
plant   130 MKQCESLLKRLMSQQHCWLFNTPVDVVKLNIPDYFTIIKHPMDLGTVKSKLTSGTYSSPSEFSAD 194

  Fly   109 FKLIFDNCLLYNLEGSPVYQAGKLLMEAFYMRMESID------------LST----EVEL-KPKS 156
            .:|.|.|.:.||...:.||:....|.:.|.:|.::|:            |:|    ::.: :|.:
plant   195 VRLTFRNAMTYNPSDNNVYRFADTLSKFFEVRWKTIEKKSSGTKSEPSNLATLAHKDIAIPEPVA 259

  Fly   157 EKRKRKATE 165
            :|||..|.:
plant   260 KKRKMNAVK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-1NP_001369030.1 Bromodomain 39..143 CDD:413371 34/98 (35%)
Bromodomain 328..423 CDD:413371
BET10NP_566151.1 Bromo_plant1 130..227 CDD:99938 33/96 (34%)
BET 279..342 CDD:407211
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.