DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-1 and brd2b

DIOPT Version :9

Sequence 1:NP_001369030.1 Gene:tbrd-1 / 42823 FlyBaseID:FBgn0039124 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001103994.1 Gene:brd2b / 569354 ZFINID:ZDB-GENE-070220-1 Length:276 Species:Danio rerio


Alignment Length:237 Identity:87/237 - (36%)
Similarity:115/237 - (48%) Gaps:27/237 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELQSNSNQPPPRNEPYLQPVNGIVQPPVIPPPNRPGRRTNILEELKSVL-NCLWRNRFSYHFRHP 66
            |..|..:.|||...|.|       |||| ..|:|.||.||.|:.|..|| ..|||:.|::.|..|
Zfish    42 ESPSLPHAPPPGPPPPL-------QPPV-RDPSRQGRATNQLQFLHKVLVKALWRHHFAWPFHEP 98

  Fly    67 VDSVSLGVPDYHAVVKHPMDLSTIRKRLHNKYYWQASEALEDFKLIFDNCLLYNLEGSPVYQAGK 131
            ||:..|.:||||.::|.|||:.||:|||.|.||..|||.|:||..:|.||.:||.....:....:
Zfish    99 VDATRLNLPDYHKIIKQPMDMGTIKKRLENNYYRGASECLQDFNTMFTNCYIYNKPADDIVLMAQ 163

  Fly   132 LLMEAFYMRMESIDLSTEVELKPKSEKRKR-----KATESLDQASTS-FSAPRASNN-YSRQWLS 189
            .|.:.|..::..:. ..|:|| |....|.|     ||.:|...:.|| ...|..|:: ||.....
Zfish   164 SLEKVFLQKVAQMP-QDEIEL-PSPTPRGRGNKSVKARKSRGGSVTSAHQVPAVSHSAYSPSSPE 226

  Fly   190 SSSSWLCPPPMPGGVSSFNPSFRNFVGPSLI--PSFMPDSLV 229
            :..|....||.....||..|       ||||  |...|.:.|
Zfish   227 TPDSQFSTPPQTLLSSSGPP-------PSLITPPHTQPTAKV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-1NP_001369030.1 Bromodomain 39..143 CDD:413371 45/104 (43%)
Bromodomain 328..423 CDD:413371
brd2bNP_001103994.1 Bromo_Brdt_I_like 70..176 CDD:99929 45/105 (43%)
Pol_alpha_B_N <161..>248 CDD:285602 23/95 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586809
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 149 1.000 Inparanoid score I4352
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000322
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100249
Panther 1 1.100 - - O PTHR22880
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.