DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-1 and baz2ba

DIOPT Version :9

Sequence 1:NP_001369030.1 Gene:tbrd-1 / 42823 FlyBaseID:FBgn0039124 Length:513 Species:Drosophila melanogaster
Sequence 2:XP_021332704.1 Gene:baz2ba / 561095 ZFINID:ZDB-GENE-070615-37 Length:2318 Species:Danio rerio


Alignment Length:162 Identity:46/162 - (28%)
Similarity:72/162 - (44%) Gaps:38/162 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELQSNSNQPPPR-------NEPYLQPVNGIVQP-PVIPPPNRP--------GRRTN--------I 43
            |..|::|..|.:       |:.     |....| .:.|.|:.|        .|..|        :
Zfish  2162 EATSSTNSTPKKATAASSQNKK-----NSASTPNQMAPKPDSPACVKRAKTARDNNRDLGLCRIL 2221

  Fly    44 LEELKSVLNCLWRNRFSYHFRHPVDSVSLGVPDYHAVVKHPMDLSTIRKRLHNKYYWQASEALED 108
            |.||:       |::.::.|.:||:..|  ||.|..|:|.|||.||||::|.:..|......:.|
Zfish  2222 LAELE-------RHQDAWPFLNPVNLKS--VPGYRKVIKKPMDFSTIREKLVSSQYQNLETFIID 2277

  Fly   109 FKLIFDNCLLYNLEGSPVYQAGKLLMEAFYMR 140
            ..|:||||..:|.:.|.:.:||..:.:.|..|
Zfish  2278 VNLVFDNCEKFNEDNSDIGRAGHNMRKFFEKR 2309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-1NP_001369030.1 Bromodomain 39..143 CDD:413371 36/110 (33%)
Bromodomain 328..423 CDD:413371
baz2baXP_021332704.1 HAT_MBD 809..880 CDD:238691
TPH 952..>1143 CDD:316391
DDT 1167..1227 CDD:214726
WSD 1450..>1470 CDD:317927
WSD <1824..1856 CDD:317927
PHD_BAZ2B 2070..2118 CDD:277100
BAH 2093..>2145 CDD:322012
ADK <2119..2209 CDD:331878 10/51 (20%)
Bromo_BAZ2A_B_like 2214..2310 CDD:99935 34/105 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.