DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-1 and nej

DIOPT Version :9

Sequence 1:NP_001369030.1 Gene:tbrd-1 / 42823 FlyBaseID:FBgn0039124 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001188575.1 Gene:nej / 43856 FlyBaseID:FBgn0261617 Length:3282 Species:Drosophila melanogaster


Alignment Length:205 Identity:61/205 - (29%)
Similarity:84/205 - (40%) Gaps:52/205 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PVIPPPNRPGR--------------RTNILEELKSVLNCLWRNR-FSYHFRHPVDSVSLGVPDYH 78
            |::|.|..|..              ||.:|..|:.    |:|.. .|..||:|||..:||:|||.
  Fly  1684 PLVPEPLAPNAGDKKKKCQFNPEELRTALLPTLEK----LYRQEPESVPFRYPVDPQALGIPDYF 1744

  Fly    79 AVVKHPMDLSTIRKRLHNKYYWQASEALEDFKLIFDNCLLYNLEGSPVYQAGKLLMEAFYMRMES 143
            .:||.||||.|||..:.|..|....|.::|..|:|||..|||.:.|.||:....|.|.|      
  Fly  1745 EIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVF------ 1803

  Fly   144 IDLSTEVELKPKSEKR----KRKATESLDQASTSFSAPRASNNYSRQWLSSSSSWLCPPPMPGGV 204
                 |.|:.|..:..    .||.|.:          |:....|.:|        ||..|.....
  Fly  1804 -----EAEIDPVMQALGYCCGRKYTFN----------PQVLCCYGKQ--------LCTIPRDAKY 1845

  Fly   205 SSFNPSFRNF 214
            .|:..|.:.:
  Fly  1846 YSYQNSLKEY 1855

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-1NP_001369030.1 Bromodomain 39..143 CDD:413371 43/118 (36%)
Bromodomain 328..423 CDD:413371
nejNP_001188575.1 ZnF_TAZ 530..600 CDD:214717
KIX 946..1024 CDD:280354
Bromo_cbp_like 1705..1812 CDD:99927 46/121 (38%)
RING_CBP-p300 1824..1906 CDD:276805 8/50 (16%)
PHD_CBP_p300 1908..1939 CDD:277032
HAT_KAT11 1970..2283 CDD:285432
ZZ_CBP 2339..2379 CDD:239077
ZnF_TAZ 2404..2476 CDD:214717
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.