Sequence 1: | NP_001369030.1 | Gene: | tbrd-1 / 42823 | FlyBaseID: | FBgn0039124 | Length: | 513 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001188575.1 | Gene: | nej / 43856 | FlyBaseID: | FBgn0261617 | Length: | 3282 | Species: | Drosophila melanogaster |
Alignment Length: | 205 | Identity: | 61/205 - (29%) |
---|---|---|---|
Similarity: | 84/205 - (40%) | Gaps: | 52/205 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 PVIPPPNRPGR--------------RTNILEELKSVLNCLWRNR-FSYHFRHPVDSVSLGVPDYH 78
Fly 79 AVVKHPMDLSTIRKRLHNKYYWQASEALEDFKLIFDNCLLYNLEGSPVYQAGKLLMEAFYMRMES 143
Fly 144 IDLSTEVELKPKSEKR----KRKATESLDQASTSFSAPRASNNYSRQWLSSSSSWLCPPPMPGGV 204
Fly 205 SSFNPSFRNF 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tbrd-1 | NP_001369030.1 | Bromodomain | 39..143 | CDD:413371 | 43/118 (36%) |
Bromodomain | 328..423 | CDD:413371 | |||
nej | NP_001188575.1 | ZnF_TAZ | 530..600 | CDD:214717 | |
KIX | 946..1024 | CDD:280354 | |||
Bromo_cbp_like | 1705..1812 | CDD:99927 | 46/121 (38%) | ||
RING_CBP-p300 | 1824..1906 | CDD:276805 | 8/50 (16%) | ||
PHD_CBP_p300 | 1908..1939 | CDD:277032 | |||
HAT_KAT11 | 1970..2283 | CDD:285432 | |||
ZZ_CBP | 2339..2379 | CDD:239077 | |||
ZnF_TAZ | 2404..2476 | CDD:214717 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5076 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |