DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-1 and Acf

DIOPT Version :9

Sequence 1:NP_001369030.1 Gene:tbrd-1 / 42823 FlyBaseID:FBgn0039124 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_536734.2 Gene:Acf / 43751 FlyBaseID:FBgn0027620 Length:1476 Species:Drosophila melanogaster


Alignment Length:135 Identity:48/135 - (35%)
Similarity:74/135 - (54%) Gaps:15/135 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RPGRRTNILEELKS-----VLNCLWRNRFSYHFRHPVDSVSLGVPDYHAVVKHPMDLSTIRKRLH 95
            |.|||||....|.|     :|..:.:::.::.|..||  ::..|||||.::|.||||:.|:.:|:
  Fly  1349 RSGRRTNEHMPLNSAALYDLLEQIMKHKAAWPFLRPV--LTSEVPDYHQIIKTPMDLAKIKSKLN 1411

  Fly    96 NKYYWQASEALEDFKLIFDNCLLYNLEGSPVYQAGKLLMEAFYMRMESIDLSTEVEL--KPKSEK 158
            ...|....|.|.|.:|:|.||.|||:||:.:|.|| ..:|.|.     ||...:::|  :|....
  Fly  1412 MGAYQLNEELLSDIQLVFRNCDLYNVEGNEIYDAG-CQLERFV-----IDRCRDMQLPFRPSDMN 1470

  Fly   159 RKRKA 163
            .:.||
  Fly  1471 GEVKA 1475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-1NP_001369030.1 Bromodomain 39..143 CDD:413371 40/108 (37%)
Bromodomain 328..423 CDD:413371
AcfNP_536734.2 WAC_Acf1_DNA_bd 26..125 CDD:287503
DDT 346..411 CDD:214726
WHIM1 505..554 CDD:292246
WHIM2 637..666 CDD:292247
WHIM3 775..813 CDD:292248
PHD_RSF1 1064..1109 CDD:277018
PHD 1244..1284 CDD:214584
Bromo_Acf1_like 1349..1463 CDD:99936 44/121 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468240
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.