DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-1 and dikar

DIOPT Version :9

Sequence 1:NP_001369030.1 Gene:tbrd-1 / 42823 FlyBaseID:FBgn0039124 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001261480.1 Gene:dikar / 38747 FlyBaseID:FBgn0261934 Length:3261 Species:Drosophila melanogaster


Alignment Length:608 Identity:115/608 - (18%)
Similarity:189/608 - (31%) Gaps:192/608 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NELQSNSNQPPPRNEPYLQPVNGIVQPPVIPPPN---RPGRRTNIL-----EE-----LKSVLNC 53
            :.|..|:|.   .|.|...|.:..:..||....|   ......|||     ||     :..||..
  Fly   841 HSLAHNNNN---NNSPTTNPTSTSLLHPVTTNNNSTYNSSNHANILSFTETEEVLQIGMHKVLVY 902

  Fly    54 LWRNRFSYHFRHPVDSVSLGVPDYHAVVKHPMDLSTIRKRLHNKYYWQASEALEDFKLIFDNCLL 118
            :..:|.::.|..||:...  .|.|:::::.||||..:..:|.:..|.:.||...||:||.:||.|
  Fly   903 VKNHRDAWPFVDPVEEDI--APRYYSIIRRPMDLLKMEDKLDSGEYHKFSEFRNDFRLIVNNCRL 965

  Fly   119 YNLEGSPVYQAGKLLMEAF----------------------YMRMES------------------ 143
            ||...:...:....|.:||                      |...:|                  
  Fly   966 YNGHNNEYTEMVNNLQDAFEKATKKYFDNLSDDEDDDPNLSYPAADSKMNVFREKYFSKKAKEET 1030

  Fly   144 --------------IDLS-TEVELKPKSEKRKRKATESLDQASTSFSAPRASNNYSRQWLSSSSS 193
                          .||| .|.|...|::|||||..:...:..|...|...:::   :.:.:...
  Fly  1031 EKDAPGRPAVSSAEEDLSEIEAEAPQKAQKRKRKEKDKRRKKKTKSKADVETDD---EDMEAERE 1092

  Fly   194 WLCPPPMPGG-----------------------------VSSFNPSFRNFVGPSLIPSFMPDSLV 229
            ...|||.|..                             .|||....:.....|           
  Fly  1093 PTPPPPPPTSKKSKTSKTGKEKEKDKEKEKDKDKEKDKETSSFKRGRKTKSDKS----------- 1146

  Fly   230 NPMQSMHPMSSMMNPIFKNNWETNEAMDPPPSEPISYRPLD--------SLA--APLPSPPMEPM 284
                     :|..:...|...:.:.|...|.|:|...|..:        |||  ..|..|....:
  Fly  1147 ---------ASKSSKKTKKGAKKSSADSDPESDPSDSRESEDYSDDDHISLAKTKSLVKPTARTI 1202

  Fly   285 TLPWPTPAPVESPASSPPPAPNPPIII------CYKSLDRMIEKSHSDHLLKSMVKRKRKQVTWA 343
            ........|.||....|.|....   :      ..|:.|..::...||..:|     |:...|.|
  Fly  1203 AAQKKKSVPAESKVKMPTPVKRQ---VKGKGKGGRKAKDDSLDSDQSDVNVK-----KQLPPTAA 1259

  Fly   344 FNQADYWRRYSQNPD---YDHDREEKLDWKILQERLDSDNFESFDGFVSSVRKMFQNA------- 398
            ...|:......::||   .|.|.:|           ||....|...|...:.|.:..:       
  Fly  1260 AALAESAAELEEDPDDPPPDEDEDE-----------DSSRSRSMSPFKVDLHKKYSKSALNDDLS 1313

  Fly   399 -----LRCFPEDGLVKVSVKKTNEIFEKRLPK-----YREL------------IATAKEKGRQLV 441
                 ::..|.....|:|.:..:|..|:|..:     ::.|            :|...:|.....
  Fly  1314 ELLTTVKKVPTAETTKLSARHQDEADEERSSRESDGDFKSLSNSRGSSEERPPVAKKGKKAESSK 1378

  Fly   442 ASREQDFRDSQNLLIKQENANKN 464
            ..:|:..||......|:::.:|:
  Fly  1379 KEKEKKGRDKDRDRDKEKDKDKS 1401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-1NP_001369030.1 Bromodomain 39..143 CDD:413371 34/135 (25%)
Bromodomain 328..423 CDD:413371 20/109 (18%)
dikarNP_001261480.1 WHIM1 100..148 CDD:292246
Bromo_gcn5_like 892..991 CDD:99941 28/100 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.