DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-1 and brd8b

DIOPT Version :9

Sequence 1:NP_001369030.1 Gene:tbrd-1 / 42823 FlyBaseID:FBgn0039124 Length:513 Species:Drosophila melanogaster
Sequence 2:XP_017214481.1 Gene:brd8b / 337414 ZFINID:ZDB-GENE-030722-10 Length:864 Species:Danio rerio


Alignment Length:177 Identity:44/177 - (24%)
Similarity:71/177 - (40%) Gaps:32/177 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KSVLNCLWR----NRFSYHFRHPV-DSVSLGVPDYHAVVKHPMDLSTIRKRLHNKYYWQASEALE 107
            |..:..:||    :|::..|..|| |.::   |.||::|..|||||.|:|.:.:......:|...
Zfish   668 KKAIMLVWRAAANHRYASVFLQPVSDDIA---PGYHSIVHRPMDLSAIKKNIESGQIRTTAEFQR 729

  Fly   108 DFKLIFDNCLLYNLEGSPVY------------QAGKLLMEAFYMRMESIDLSTEVELKPKSEKRK 160
            |..|:|.|.::||.....||            |..:.|.....|:.....:||: .|:.:...||
Zfish   730 DIMLMFQNAVMYNSSDHDVYHMALEMQRDVLEQIQQFLATQLIMQTSESGISTK-SLRGREANRK 793

  Fly   161 RKATESLDQASTSFSAP---------RASNNYSRQWLSSSSSWLCPP 198
            :...|.  ..|.:...|         |..||..:..:...|..:..|
Zfish   794 QDPNEK--TLSPAHKEPHLEPEPPARRKRNNSKQDTVEKDSLSMASP 838

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-1NP_001369030.1 Bromodomain 39..143 CDD:413371 31/111 (28%)
Bromodomain 328..423 CDD:413371
brd8bXP_017214481.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.