DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment tbrd-1 and bptf

DIOPT Version :9

Sequence 1:	NP_001369030.1	Gene:	tbrd-1 / 42823	FlyBaseID:	FBgn0039124	Length:	513	Species:	Drosophila melanogaster
Sequence 2:	XP_009297692.1	Gene:	bptf / 324479	ZFINID:	ZDB-GENE-030131-3200	Length:	2900	Species:	Danio rerio

Alignment Length:	149	Identity:	49/149 - (32%)
Similarity:	72/149 - (48%)	Gaps:	36/149 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly    45 EELKSVLNCLWRNRFSYHFRHPVDSVSLGVPDYHAVVKHPMDLSTIRKRLHNKYYWQASEALEDF 109
            |.||.:|..|..::.::.|..|||...  .|||:.::|.||||||:.:|:..::|.:.:|.:.|.
Zfish  2788 EGLKRILRSLQSHKMAWPFLEPVDPND--APDYYGIIKEPMDLSTMEERIQKRFYSKLTEFVADM 2850

  Fly   110 KLIFDNCLLYNLEGSPVYQAGKLLMEAFYMRMESIDLSTEVELKPKSEKRKRKATESLDQASTSF 174
            ..|||||..||...||.||..:.| |:|::                   :|.||          |
Zfish  2851 TKIFDNCRYYNPSDSPFYQCAEFL-ESFFV-------------------QKLKA----------F 2885

  Fly   175 SAPRASNNYSRQWLSSSSS 193
            .|.|:.||.    |.||:|
Zfish  2886 KASRSHNNK----LQSSAS 2900

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
tbrd-1	NP_001369030.1	Bromodomain	39..143	CDD:413371	37/97 (38%)
tbrd-1	NP_001369030.1	Bromodomain	328..423	CDD:413371
bptf	XP_009297692.1	DDT	198..254	CDD:280886
		WHIM1	296..345	CDD:292246
		PHD1_BPTF	349..391	CDD:277034
		WHIM2	414..439	CDD:292247
		PP28	<1833..1881	CDD:287254
		PHD2_3_BPTF	2665..2711	CDD:277035
		PHD2_3_BPTF	2723..2769	CDD:277035
		Bromo_gcn5_like	2785..2885	CDD:99941	40/128 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5076
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900