DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-1 and KAT2A

DIOPT Version :9

Sequence 1:NP_001369030.1 Gene:tbrd-1 / 42823 FlyBaseID:FBgn0039124 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001363156.1 Gene:KAT2A / 2648 HGNCID:4201 Length:838 Species:Homo sapiens


Alignment Length:101 Identity:28/101 - (27%)
Similarity:50/101 - (49%) Gaps:9/101 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NILEELKSVLNCLWRNRFSYHFRHPVDSVSLGVPDYHAVVKHPMDLSTIRKRLHNKYYWQASEAL 106
            |:|.::||       :..::.|..||....  .|||:.|::.|:||.|:.:||.::||......:
Human   740 NLLAQIKS-------HPSAWPFMEPVKKSE--APDYYEVIRFPIDLKTMTERLRSRYYVTRKLFV 795

  Fly   107 EDFKLIFDNCLLYNLEGSPVYQAGKLLMEAFYMRME 142
            .|.:.:..||..||...|...:....|.:.||.:::
Human   796 ADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLK 831

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-1NP_001369030.1 Bromodomain 39..143 CDD:413371 28/101 (28%)
Bromodomain 328..423 CDD:413371
KAT2ANP_001363156.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..99
PCAF_N 89..335 CDD:368925
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 407..434
COG5076 492..833 CDD:227408 28/101 (28%)
Acetyl-CoA and acyl-CoA binding. /evidence=ECO:0000269|PubMed:17410582, ECO:0000269|PubMed:29211711, ECO:0007744|PDB:5TRL 579..581
Acetyl-CoA and acyl-CoA binding. /evidence=ECO:0000269|PubMed:17410582, ECO:0000269|PubMed:29211711, ECO:0007744|PDB:5TRL 586..592
Acetyl-CoA and acyl-CoA binding. /evidence=ECO:0000269|PubMed:17410582, ECO:0000269|PubMed:29211711, ECO:0007744|PDB:5TRL 617..620
Loop 3. /evidence=ECO:0000269|PubMed:29211711 639..648
Bromo_gcn5_like 733..832 CDD:99941 28/101 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.