DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-1 and Bptf

DIOPT Version :9

Sequence 1:NP_001369030.1 Gene:tbrd-1 / 42823 FlyBaseID:FBgn0039124 Length:513 Species:Drosophila melanogaster
Sequence 2:XP_006532738.1 Gene:Bptf / 207165 MGIID:2444008 Length:3158 Species:Mus musculus


Alignment Length:120 Identity:41/120 - (34%)
Similarity:64/120 - (53%) Gaps:9/120 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EELKSVLNCLWRNRFSYHFRHPVDSVSLGVPDYHAVVKHPMDLSTIRKRLHNKYYWQASEALEDF 109
            |.||.||..|..::.::.|..|||...  .|||:.|:|.||||:|:.:|:..:||.:.:|.:.|.
Mouse  3046 EGLKRVLRSLQAHKMAWPFLEPVDPND--APDYYGVIKEPMDLATMEERIQKRYYEKLTEFVADM 3108

  Fly   110 KLIFDNCLLYNLEGSPVYQAGKLLMEAFYMRMESIDLSTEVELKPKSEKRKRKAT 164
            ..|||||..||...:|.||..::|...|..:::....|       :|...|.::|
Mouse  3109 TKIFDNCRYYNPRDTPFYQCAEVLESFFVQKLKGFKAS-------RSHNNKLQST 3156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-1NP_001369030.1 Bromodomain 39..143 CDD:413371 37/97 (38%)
Bromodomain 328..423 CDD:413371
BptfXP_006532738.1 DDT 253..309 CDD:367184
WHIM1 356..393 CDD:373966
PHD1_BPTF 404..446 CDD:277034
WSD 468..536 CDD:373967
MDN1 <578..749 CDD:227596
DUF5585 <2038..2345 CDD:375359
Med15 <2246..>2609 CDD:312941
TPH 2696..>2836 CDD:372768
PHD2_3_BPTF 2923..2969 CDD:277035
PHD2_3_BPTF 2981..3027 CDD:277035
Bromo_gcn5_like 3043..3143 CDD:99941 37/98 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.