DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-1 and sepa-1

DIOPT Version :9

Sequence 1:NP_001369030.1 Gene:tbrd-1 / 42823 FlyBaseID:FBgn0039124 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_493339.1 Gene:sepa-1 / 173196 WormBaseID:WBGene00010808 Length:702 Species:Caenorhabditis elegans


Alignment Length:415 Identity:72/415 - (17%)
Similarity:116/415 - (27%) Gaps:176/415 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 PVYQAGKLLMEAFYMRMESI--DLSTEVELKPKSE-KRKRKATESL-----------------DQ 169
            ||...|:.:||.....:||.  ||..|:.|....| .||....||.                 |.
 Worm   389 PVQTEGEDIMETVLAMVESFNCDLRKELGLTQDQEIPRKAPRVESAETEENIVKNLEKLQIAKDP 453

  Fly   170 ASTSFSAPRASNNYSRQWLSSSSSWLCPPPMPGGVSSFNPSFRNFVGPSLIPSFMPDSLVNPMQS 234
            ...:.:|....|.|..|.|..:        |..|:                       |....:|
 Worm   454 EEPTTAASEGGNTYGYQELDDT--------MSEGL-----------------------LEKEAES 487

  Fly   235 MHPMSSMMNPIFKNNWETNEAMDPPPSEPISYRP-----------------LDSLAAPLPSPPME 282
            .|                .:|.:|.|.:.::|.|                 |:.:.|.:......
 Worm   488 KH----------------QDANEPEPVKNVTYEPDVAAMDKKKKRRELKSRLNKINAQIDELEKR 536

  Fly   283 PM-----------TLPWPTPAPVESPASSPPPAPN--------PPIIICYKSLD----------- 317
            .|           ::|....|.||:|| ||..|.|        .|.|..::..:           
 Worm   537 RMERAGKKQVVSSSVPSEEAAQVEAPA-SPALAENTNQISNEETPKIDIFEGYNGSFLFGTNTSK 600

  Fly   318 RMIEKSHSDHLLKSMVKRKRKQVTWAFNQADYWRRYSQNPDYDHDREEKLDWKILQERLDSDNFE 382
            ..|.:...:|::..::|.             :|.|.                         .|.|
 Worm   601 EWIVEDIRNHMVGKLLKA-------------FWPRI-------------------------QNVE 627

  Fly   383 SFDGFVSSVRKMFQNALRCFPE--------DGLVKVSVKKTNEIFEKRLPKYRELIATAKEKGRQ 439
            ..:|  ...:|:..||.:|..|        |...::.....::|.:|          |.|:..|.
 Worm   628 EMNG--ELFKKLIANARKCETEILEASNDRDEYYRLMQLTVDQILKK----------TLKKDQRA 680

  Fly   440 LVASREQDFRDSQNLLIKQENANKN 464
            ...:.:|..:.|..|   .:|..||
 Worm   681 TEHNHQQPTQSSDEL---AKNHEKN 702

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-1NP_001369030.1 Bromodomain 39..143 CDD:413371 5/17 (29%)
Bromodomain 328..423 CDD:413371 14/102 (14%)
sepa-1NP_493339.1 KIX 600..676 CDD:280354 17/125 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.