DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-1 and Kat2a

DIOPT Version :9

Sequence 1:NP_001369030.1 Gene:tbrd-1 / 42823 FlyBaseID:FBgn0039124 Length:513 Species:Drosophila melanogaster
Sequence 2:XP_017169759.2 Gene:Kat2a / 14534 MGIID:1343101 Length:907 Species:Mus musculus


Alignment Length:101 Identity:28/101 - (27%)
Similarity:50/101 - (49%) Gaps:9/101 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NILEELKSVLNCLWRNRFSYHFRHPVDSVSLGVPDYHAVVKHPMDLSTIRKRLHNKYYWQASEAL 106
            |:|.::||       :..::.|..||....  .|||:.|::.|:||.|:.:||.::||......:
Mouse   809 NLLAQIKS-------HPSAWPFMEPVKKSE--APDYYEVIRFPIDLKTMTERLRSRYYVTRKLFV 864

  Fly   107 EDFKLIFDNCLLYNLEGSPVYQAGKLLMEAFYMRME 142
            .|.:.:..||..||...|...:....|.:.||.:::
Mouse   865 ADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLK 900

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-1NP_001369030.1 Bromodomain 39..143 CDD:413371 28/101 (28%)
Bromodomain 328..423 CDD:413371
Kat2aXP_017169759.2 PCAF_N 129..378 CDD:399460
COG5076 533..902 CDD:227408 28/101 (28%)
Bromo_gcn5_like 802..901 CDD:99941 28/101 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.