DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-1 and Baz2a

DIOPT Version :9

Sequence 1:NP_001369030.1 Gene:tbrd-1 / 42823 FlyBaseID:FBgn0039124 Length:513 Species:Drosophila melanogaster
Sequence 2:XP_011241580.1 Gene:Baz2a / 116848 MGIID:2151152 Length:1888 Species:Mus musculus


Alignment Length:135 Identity:42/135 - (31%)
Similarity:61/135 - (45%) Gaps:32/135 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PVIP--------PPNRPGRRTN-------------ILEELKSVLNCLWRNRFSYHFRHPVDSVSL 72
            |.:|        ||.|  ||.:             ||.|::|       :..::.|..||:... 
Mouse  1755 PAVPRYPEDGLSPPKR--RRHSMRSHHSDLTFCEIILMEMES-------HDAAWPFLEPVNPRL- 1809

  Fly    73 GVPDYHAVVKHPMDLSTIRKRLHNKYYWQASEALEDFKLIFDNCLLYNLEGSPVYQAGKLLMEAF 137
             |..|..|:|:|||.||:|:||....|..:.|...|..|:||||..:|.:.|.|.:||.::...|
Mouse  1810 -VSGYRRVIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFNEDDSEVGKAGHVMRRFF 1873

  Fly   138 YMRME 142
            ..|.|
Mouse  1874 ESRWE 1878

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-1NP_001369030.1 Bromodomain 39..143 CDD:413371 37/117 (32%)
Bromodomain 328..423 CDD:413371
Baz2aXP_011241580.1 PHA03307 269..>517 CDD:223039
PRK07003 <408..>534 CDD:235906
HAT_MBD 542..614 CDD:238691
DDT 840..902 CDD:214726
WSD 1101..>1132 CDD:373967
Atrophin-1 <1151..>1421 CDD:367360
WSD <1424..1458 CDD:373967
PHD_BAZ2A 1663..1709 CDD:277099
Bromo_BAZ2A_B_like 1781..1877 CDD:99935 33/104 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.