DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-1 and BAZ1A

DIOPT Version :9

Sequence 1:NP_001369030.1 Gene:tbrd-1 / 42823 FlyBaseID:FBgn0039124 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_038476.2 Gene:BAZ1A / 11177 HGNCID:960 Length:1556 Species:Homo sapiens


Alignment Length:155 Identity:41/155 - (26%)
Similarity:74/155 - (47%) Gaps:23/155 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PPPNRPGRRT-------NILEELKSVLNCLWRNRFSYHFRHPVDSVSLGVPDYHAVVKHPMDLST 89
            |.|...|||:       :.|...:.::..|.|:..|:.|...|..:.  ||||:.::|.|:.|:.
Human  1416 PSPVTLGRRSSGRQGGVHELSAFEQLVVELVRHDDSWPFLKLVSKIQ--VPDYYDIIKKPIALNI 1478

  Fly    90 IRKRLHNKYYWQASEALEDFKLIFDNCLLYNLEGSPVYQAGKLLMEAFYMRMESIDLSTEVELKP 154
            ||::::...|..|||.::|.:|:|.||..||...:...:||..|...|:::.:.:.|..      
Human  1479 IREKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHV------ 1537

  Fly   155 KSEKRKRKATESLDQASTSFSAPRA 179
                    ...::||.||..:|.::
Human  1538 --------TPSNVDQVSTPPAAKKS 1554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-1NP_001369030.1 Bromodomain 39..143 CDD:413371 32/110 (29%)
Bromodomain 328..423 CDD:413371
BAZ1ANP_038476.2 Required for interaction with NCOR1. /evidence=ECO:0000269|PubMed:17519354 1..133
Required for association with the CHRAC1/POLE3 complex 1..128
WAC_Acf1_DNA_bd 23..122 CDD:313708
DDT 422..485 CDD:214726
WHIM1 590..635 CDD:317926
Neuromodulin_N <645..788 CDD:331332
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 662..754
Interaction with SMARCA5 667..933
WSD 800..926 CDD:317927
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 841..877
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 941..966
PHD_BAZ1A 1150..1195 CDD:277097
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1202..1376
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1399..1431 5/14 (36%)
Bromo_Acf1_like 1423..1535 CDD:99936 32/113 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.