DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-1 and BRD8

DIOPT Version :9

Sequence 1:NP_001369030.1 Gene:tbrd-1 / 42823 FlyBaseID:FBgn0039124 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_631938.2 Gene:BRD8 / 10902 HGNCID:19874 Length:1235 Species:Homo sapiens


Alignment Length:505 Identity:98/505 - (19%)
Similarity:166/505 - (32%) Gaps:145/505 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KSVLNCLWR----NRFSYHFRHPV-DSVSLGVPDYHAVVKHPMDLSTIRKRLHNKYYWQASEALE 107
            |..:..:||    :|::..|..|| |.::   |.||::|:.|||||||:|.:.|......:|...
Human   713 KKAIMLVWRAAANHRYANVFLQPVTDDIA---PGYHSIVQRPMDLSTIKKNIENGLIRSTAEFQR 774

  Fly   108 DFKLIFDNCLLYNLEGSPVY------------QAGKLLMEAFYMRMESIDLSTEVELKPKSEKRK 160
            |..|:|.|.::||.....||            |..:.|.....|:.....:|.: .|:.:...||
Human   775 DIMLMFQNAVMYNSSDHDVYHMAVEMQRDVLEQIQQFLATQLIMQTSESGISAK-SLRGRDSTRK 838

  Fly   161 RKATE--SLDQASTSFSAPRASNNYSRQWLSSS-----------------SSWLCPPPMPGGVSS 206
            :.|:|  |:...|.:|.. .....:...||.|.                 |||.....:..|   
Human   839 QDASEKDSVPMGSPAFLL-SLFMGHEWVWLDSEQDHPNDSELSNDCRSLFSSWDSSLDLDVG--- 899

  Fly   207 FNPSFRNFVGPSL------IPSFMPDSLV-------------------NPMQSMHPMSSMMNPIF 246
               ::|....|..      .|...|..|:                   |.:..:..::.:|.|:.
Human   900 ---NWRETEDPEAEELEESSPEREPSELLVGDGGSEESQEAARKASHQNLLHFLSEVAYLMEPLC 961

  Fly   247 KNNWETNEAMDPP-------------PSEPISYRPLDSLAA---PL-PSPPMEPMTLPWPTPAP- 293
            .::.|::|...||             ..|....|..:.|:|   || ...|:.....|....|| 
Human   962 ISSNESSEGCCPPSGTRQEGREIKASEGERELCRETEELSAKGDPLVAEKPLGENGKPEVASAPS 1026

  Fly   294 ------------------------------VESPASSPP-----------PAPNPPIIICYKSLD 317
                                          |......||           ..|....:..:.:..
Human  1027 VICTVQGLLTESEEGEAQQESKGEDQGEVYVSEMEDQPPSGECDDAFNIKETPLVDTLFSHATSS 1091

  Fly   318 RMIEKSHSDHLLKSMVKRKRKQVTWAFNQADYWRRYS----------QNPDYDHDREEKLDWKIL 372
            ::.:.|..|.:...::.:|.....|....:   .|:|          |.|.|....:..:|...|
Human  1092 KLTDLSQDDPVQDHLLFKKTLLPVWKMIAS---HRFSSPFLKPVSERQAPGYKDVVKRPMDLTSL 1153

  Fly   373 QERLDSDNFESFDGFVSSVRKMFQNALRCFPEDGLV-KVSVKKTNEIFEK 421
            :..|......:...|:..:..|||||:.....|..| .::|:...|:.|:
Human  1154 KRNLSKGRIRTMAQFLRDLMLMFQNAVMYNDSDHHVYHMAVEMRQEVLEQ 1203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-1NP_001369030.1 Bromodomain 39..143 CDD:413371 33/111 (30%)
Bromodomain 328..423 CDD:413371 21/105 (20%)
BRD8NP_631938.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..205
termin_org_DnaJ <302..>681 CDD:274808
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 551..597
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 621..672
Bromo_brd8_like 709..812 CDD:99939 31/101 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 827..848 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 903..940 4/36 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 966..999 6/32 (19%)
Bromo_brd8_like 1105..1208 CDD:99939 21/102 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.