DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-1 and baz2b

DIOPT Version :9

Sequence 1:NP_001369030.1 Gene:tbrd-1 / 42823 FlyBaseID:FBgn0039124 Length:513 Species:Drosophila melanogaster
Sequence 2:XP_012826514.1 Gene:baz2b / 100151715 XenbaseID:XB-GENE-964622 Length:2186 Species:Xenopus tropicalis


Alignment Length:122 Identity:39/122 - (31%)
Similarity:60/122 - (49%) Gaps:11/122 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PPNRPGRRTNILEELKSVLNC------LWRNRFSYHFRHPVDSVSLGVPDYHAVVKHPMDLSTIR 91
            |.::..|...  ||||.:..|      :..:..::.|..|| ::.| ||.|..|:|.|||.:|||
 Frog  2069 PSSKKARSAK--EELKDLSLCSVILSEMESHEDAWPFLLPV-NLKL-VPGYKKVIKKPMDFATIR 2129

  Fly    92 KRLHNKYYWQASEALEDFKLIFDNCLLYNLEGSPVYQAGKLLMEAFYMR-MESIDLS 147
            .:|.|..|........|.:|:|:||..:|.:.|.:.:||..:...|..| .|..:||
 Frog  2130 DKLSNGQYPSFEAFALDVRLVFNNCETFNEDESEIGRAGHKMRVHFEKRWTELFNLS 2186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-1NP_001369030.1 Bromodomain 39..143 CDD:413371 35/110 (32%)
Bromodomain 328..423 CDD:413371
baz2bXP_012826514.1 HAT_MBD 727..799 CDD:238691
CCDC66 851..1006 CDD:291889
GBP_C <868..987 CDD:303769
DUF4200 964..1055 CDD:290574
coiled coil 978..987 CDD:293879
DDT 1083..1145 CDD:214726
WHIM3 1706..1744 CDD:292248
PHD_BAZ2B 1953..2001 CDD:277100
BAH 1976..>2032 CDD:295389
Bromo_BAZ2A_B_like 2083..2179 CDD:99935 29/97 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.