DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIA-S and Gtf2a2

DIOPT Version :9

Sequence 1:NP_524467.1 Gene:TfIIA-S / 42822 FlyBaseID:FBgn0013347 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_445797.1 Gene:Gtf2a2 / 83828 RGDID:620720 Length:109 Species:Rattus norvegicus


Alignment Length:103 Identity:81/103 - (78%)
Similarity:92/103 - (89%) Gaps:1/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYQLYRNTTLGNTLQESLDELIQYGQITPGLAFKVLLQFDKSINNALNQRVKARVTFKAGKLNT 65
            |:|||||||||||:||||||||||..||||.||.:|||||||:||:||.|||:.||.|: |.|||
  Rat     1 MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFR-GSLNT 64

  Fly    66 YRFCDNVWTLMLNDVEFREVHEIVKVDKVKIVACDGKS 103
            |||||||||.:|||||||||.|::|||||||||||||:
  Rat    65 YRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKN 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIA-SNP_524467.1 TOA2 3..105 CDD:227452 80/101 (79%)
Gtf2a2NP_445797.1 TOA2 3..103 CDD:227452 80/101 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347727
Domainoid 1 1.000 80 1.000 Domainoid score I8412
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3304
Inparanoid 1 1.050 163 1.000 Inparanoid score I4110
OMA 1 1.010 - - QHG55551
OrthoDB 1 1.010 - - D1589933at2759
OrthoFinder 1 1.000 - - FOG0003136
OrthoInspector 1 1.000 - - oto98840
orthoMCL 1 0.900 - - OOG6_103706
Panther 1 1.100 - - LDO PTHR10966
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2529
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.