DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIA-S and AT4G24440

DIOPT Version :9

Sequence 1:NP_524467.1 Gene:TfIIA-S / 42822 FlyBaseID:FBgn0013347 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_194175.1 Gene:AT4G24440 / 828546 AraportID:AT4G24440 Length:106 Species:Arabidopsis thaliana


Alignment Length:101 Identity:52/101 - (51%)
Similarity:72/101 - (71%) Gaps:1/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SYQLYRNTTLGNTLQESLDELIQYGQITPGLAFKVLLQFDKSINNALNQRVKARVTFKAGKLNTY 66
            :::|||.:|:|..|.|:|||::|.|.::|.||.:||:|||||:..||..:||.:|:.| |.|:||
plant     3 TFELYRRSTIGMCLTETLDEMVQSGTLSPELAIQVLVQFDKSMTEALESQVKTKVSIK-GHLHTY 66

  Fly    67 RFCDNVWTLMLNDVEFREVHEIVKVDKVKIVACDGK 102
            ||||||||.:|.|..|:.......|.:|||||||.|
plant    67 RFCDNVWTFILQDAMFKSDDRQENVSRVKIVACDSK 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIA-SNP_524467.1 TOA2 3..105 CDD:227452 52/100 (52%)
AT4G24440NP_194175.1 TOA2 4..103 CDD:227452 52/100 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 55 1.000 Domainoid score I4119
eggNOG 1 0.900 - - E1_COG5123
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3304
Inparanoid 1 1.050 109 1.000 Inparanoid score I2080
OMA 1 1.010 - - QHG55551
OrthoDB 1 1.010 - - D1589933at2759
OrthoFinder 1 1.000 - - FOG0003136
OrthoInspector 1 1.000 - - otm3259
orthoMCL 1 0.900 - - OOG6_103706
Panther 1 1.100 - - LDO PTHR10966
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2529
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.