DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIA-S and gtf2a2

DIOPT Version :9

Sequence 1:NP_524467.1 Gene:TfIIA-S / 42822 FlyBaseID:FBgn0013347 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001018441.1 Gene:gtf2a2 / 798997 ZFINID:ZDB-GENE-050522-513 Length:109 Species:Danio rerio


Alignment Length:103 Identity:80/103 - (77%)
Similarity:90/103 - (87%) Gaps:1/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYQLYRNTTLGNTLQESLDELIQYGQITPGLAFKVLLQFDKSINNALNQRVKARVTFKAGKLNT 65
            |:|||||||||||:||||||||||..||||.||.:|||||||:||.||..||:.||.|: |.|||
Zfish     1 MAYQLYRNTTLGNSLQESLDELIQTQQITPQLALQVLLQFDKAINTALANRVRNRVNFR-GSLNT 64

  Fly    66 YRFCDNVWTLMLNDVEFREVHEIVKVDKVKIVACDGKS 103
            |||||||||.:|||||||||.::||||||||||||||:
Zfish    65 YRFCDNVWTFVLNDVEFREVTDLVKVDKVKIVACDGKN 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIA-SNP_524467.1 TOA2 3..105 CDD:227452 79/101 (78%)
gtf2a2NP_001018441.1 TOA2 3..103 CDD:227452 79/101 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589262
Domainoid 1 1.000 79 1.000 Domainoid score I8654
eggNOG 1 0.900 - - E1_COG5123
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3304
Inparanoid 1 1.050 160 1.000 Inparanoid score I4219
OMA 1 1.010 - - QHG55551
OrthoDB 1 1.010 - - D1589933at2759
OrthoFinder 1 1.000 - - FOG0003136
OrthoInspector 1 1.000 - - oto41587
orthoMCL 1 0.900 - - OOG6_103706
Panther 1 1.100 - - LDO PTHR10966
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1463
SonicParanoid 1 1.000 - - X2529
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.