DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIA-S and Gtf2a2

DIOPT Version :9

Sequence 1:NP_524467.1 Gene:TfIIA-S / 42822 FlyBaseID:FBgn0013347 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001034608.1 Gene:Gtf2a2 / 235459 MGIID:1933289 Length:109 Species:Mus musculus


Alignment Length:103 Identity:81/103 - (78%)
Similarity:92/103 - (89%) Gaps:1/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYQLYRNTTLGNTLQESLDELIQYGQITPGLAFKVLLQFDKSINNALNQRVKARVTFKAGKLNT 65
            |:|||||||||||:||||||||||..||||.||.:|||||||:||:||.|||:.||.|: |.|||
Mouse     1 MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFR-GSLNT 64

  Fly    66 YRFCDNVWTLMLNDVEFREVHEIVKVDKVKIVACDGKS 103
            |||||||||.:|||||||||.|::|||||||||||||:
Mouse    65 YRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKN 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIA-SNP_524467.1 TOA2 3..105 CDD:227452 80/101 (79%)
Gtf2a2NP_001034608.1 TOA2 3..103 CDD:227452 80/101 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844359
Domainoid 1 1.000 80 1.000 Domainoid score I8581
eggNOG 1 0.900 - - E1_COG5123
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3304
Inparanoid 1 1.050 163 1.000 Inparanoid score I4198
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55551
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003136
OrthoInspector 1 1.000 - - oto95353
orthoMCL 1 0.900 - - OOG6_103706
Panther 1 1.100 - - LDO PTHR10966
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1463
SonicParanoid 1 1.000 - - X2529
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.