DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIA-S and gtf-2A2

DIOPT Version :9

Sequence 1:NP_524467.1 Gene:TfIIA-S / 42822 FlyBaseID:FBgn0013347 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_499644.1 Gene:gtf-2A2 / 176682 WormBaseID:WBGene00013736 Length:113 Species:Caenorhabditis elegans


Alignment Length:102 Identity:49/102 - (48%)
Similarity:70/102 - (68%) Gaps:0/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SYQLYRNTTLGNTLQESLDELIQYGQITPGLAFKVLLQFDKSINNALNQRVKARVTFKAGKLNTY 66
            :||||||||||..||::||:.:....|...|:.|::..||||||..|..:.|.:|.|:|.||..|
 Worm     5 NYQLYRNTTLGQALQKTLDDFVGDQMIPDSLSKKIMDSFDKSINKILPHKAKNKVNFRADKLRAY 69

  Fly    67 RFCDNVWTLMLNDVEFREVHEIVKVDKVKIVACDGKS 103
            |:||||||.::..::.|:..|...||::|||||||::
 Worm    70 RYCDNVWTFIVEQIDLRDAVEGGTVDRLKIVACDGQT 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIA-SNP_524467.1 TOA2 3..105 CDD:227452 49/101 (49%)
gtf-2A2NP_499644.1 TFIIA_gamma_N 5..53 CDD:199901 24/47 (51%)
TOA2 6..105 CDD:227452 48/98 (49%)
TFIIA_gamma_C 55..104 CDD:280847 23/48 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I7288
eggNOG 1 0.900 - - E1_COG5123
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3304
Inparanoid 1 1.050 106 1.000 Inparanoid score I3505
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55551
OrthoDB 1 1.010 - - D1589933at2759
OrthoFinder 1 1.000 - - FOG0003136
OrthoInspector 1 1.000 - - otm14768
orthoMCL 1 0.900 - - OOG6_103706
Panther 1 1.100 - - LDO PTHR10966
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1463
SonicParanoid 1 1.000 - - X2529
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.