DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIA-S and B0336.13

DIOPT Version :9

Sequence 1:NP_524467.1 Gene:TfIIA-S / 42822 FlyBaseID:FBgn0013347 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001379557.1 Gene:B0336.13 / 175791 WormBaseID:WBGene00015150 Length:139 Species:Caenorhabditis elegans


Alignment Length:103 Identity:48/103 - (46%)
Similarity:70/103 - (67%) Gaps:2/103 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SYQLYRNTTLGNTLQESLDELIQYGQITPGLAFKVLLQFDKSINNALNQRVKARVTFKAGKLNTY 66
            ||.|||.||||..|.::|:::...|.:|..||.|||.|||||:|..:::..|.::.|.|.:|.||
 Worm     3 SYALYRGTTLGQALDKTLEDMESEGLLTKSLASKVLQQFDKSMNKQISRLPKEKMNFCATQLLTY 67

  Fly    67 RFCDNVWTLMLNDVEFREVHEIV--KVDKVKIVACDGK 102
            |:||||||.:||:|..::.....  .:||:|:|||||:
 Worm    68 RYCDNVWTFILNNVTLKDPQRSFDEPIDKLKVVACDGR 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIA-SNP_524467.1 TOA2 3..105 CDD:227452 47/102 (46%)
B0336.13NP_001379557.1 TOA2 4..108 CDD:227452 47/102 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I7812
eggNOG 1 0.900 - - E1_COG5123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55551
OrthoDB 1 1.010 - - D1589933at2759
OrthoFinder 1 1.000 - - FOG0003136
OrthoInspector 1 1.000 - - otm14247
orthoMCL 1 0.900 - - OOG6_103706
Panther 1 1.100 - - O PTHR10966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2529
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.790

Return to query results.
Submit another query.